Recombinant Human TNNC1 Protein

Beta LifeScience SKU/CAT #: BLA-9086P
Recombinant Human TNNC1 Protein

Recombinant Human TNNC1 Protein

Beta LifeScience SKU/CAT #: BLA-9086P
Catalog No.: BLA-9086P

Product Overview

Host Species Human
Accession P63316
Synonym Cardiac troponin C CMD1Z CMH13 slow skeletal and cardiac muscles Slow twitch skeletal/cardiac muscle troponin C TN-C TNC TNNC Tnnc1 TNNC1 troponin C type 1 (slow) TNNC1_HUMAN Troponin C troponin C type 1 (slow) Troponin C, slow skeletal and cardiac muscles Troponin C1, slow
Description Recombinant Human TNNC1 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMDDIYKAAVEQLTEEQKNEFKAAFDIFVLG AEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVM MVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITE DDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Molecular Weight 21 kDa including tags
Purity Greater than 95% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed