Recombinant Human TMEM97 Protein

Beta LifeScience SKU/CAT #: BLA-9073P
Recombinant Human TMEM97 Protein

Recombinant Human TMEM97 Protein

Beta LifeScience SKU/CAT #: BLA-9073P
Catalog No.: BLA-9073P

Product Overview

Host Species Human
Synonym MAC30 Protein MAC30 Tmem97 TMM97_HUMAN Transmembrane protein 97
Description Recombinant Human TMEM97 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MTTLIPILSTFLFEDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFIL LIFMLRSPYYKYEEKRKKK
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed