Recombinant Human TLT-1 Protein

Beta LifeScience SKU/CAT #: BLA-9062P
Recombinant Human TLT-1 Protein

Recombinant Human TLT-1 Protein

Beta LifeScience SKU/CAT #: BLA-9062P
Catalog No.: BLA-9062P

Product Overview

Host Species Human
Accession Q86YW5
Synonym dJ238O23.3 GLTL1825 MGC119173 PRO3438 TLT 1 TLT-1 TLT1 TREM like transcript 1 Trem like transcript 1 protein Trem-like transcript 1 protein TREML 1 Treml1 Triggering receptor expressed on myeloid cells like 1 Triggering receptor expressed on myeloid cells like protein 1 Triggering receptor expressed on myeloid cells-like protein 1 TRML1_HUMAN
Description Recombinant Human TLT-1 Protein was expressed in HEK293. It is a Protein fragment
Source HEK293
AA Sequence QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSS AVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQIL HRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIPVDH HHHHH
Molecular Weight 17 kDa including tags
Purity Greater than 95% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. The lyo
Recently viewed