Recombinant Human TLT-1 Protein
Beta LifeScience
SKU/CAT #: BLA-9062P
Recombinant Human TLT-1 Protein
Beta LifeScience
SKU/CAT #: BLA-9062P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q86YW5 |
Synonym | dJ238O23.3 GLTL1825 MGC119173 PRO3438 TLT 1 TLT-1 TLT1 TREM like transcript 1 Trem like transcript 1 protein Trem-like transcript 1 protein TREML 1 Treml1 Triggering receptor expressed on myeloid cells like 1 Triggering receptor expressed on myeloid cells like protein 1 Triggering receptor expressed on myeloid cells-like protein 1 TRML1_HUMAN |
Description | Recombinant Human TLT-1 Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSS AVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQIL HRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIPVDH HHHHH |
Molecular Weight | 17 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. The lyo |