Recombinant Human TLR6 Protein

Beta LifeScience SKU/CAT #: BLA-9058P
Recombinant Human TLR6 Protein

Recombinant Human TLR6 Protein

Beta LifeScience SKU/CAT #: BLA-9058P
Catalog No.: BLA-9058P

Product Overview

Host Species Human
Synonym CD286 CD286 antigen TLR 6 Tlr6 TLR6_HUMAN Toll like receptor 6 precursor Toll-like receptor 6
Description Recombinant Human TLR6 Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence LVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIKFLSELTRGST LLNFTLNHIETTWKCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYS
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed