Recombinant Human TLR2 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9051P
Recombinant Human TLR2 Protein (His tag)

Recombinant Human TLR2 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9051P
Catalog No.: BLA-9051P

Product Overview

Host Species Human
Accession O60603
Synonym CD282 CD282 antigen TIL 4 TIL4 TLR 2 TLR2 TLR2_HUMAN Toll like receptor 2 Toll like receptor 2 precursor Toll-like receptor 2 Toll/interleukin 1 receptor like 4 Toll/interleukin 1 receptor like protein 4 Toll/interleukin receptor like protein 4 Toll/interleukin-1 receptor-like protein 4
Description Recombinant Human TLR2 Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Protein fragment
Source Baculovirus infected insect cells
AA Sequence KEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLSNNRITYIS NSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSS WFKPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRK DFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFV DVTSSVECLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQ VMKLLNQISGLLELEFDDCTLNGVGNFRASDNDRVIDPGKVETLTIRRLH IPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLKSLEYLDLS ENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNI DISKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNN LNLFSLNLPQLKELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQ LDSFHTLKTLEAGGNNFICSCEFLSFTQEQQALAKVLIDWPANYLCDSPS HVRGQQVQDVRLSVSECHRTLEHHHHHH
Molecular Weight 66 kDa including tags
Purity >90% purity as determined by SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed