Recombinant Human TIMP1 Protein

Beta LifeScience SKU/CAT #: BLA-9014P
Recombinant Human TIMP1 Protein

Recombinant Human TIMP1 Protein

Beta LifeScience SKU/CAT #: BLA-9014P
Catalog No.: BLA-9014P

Product Overview

Host Species Human
Accession P01033
Synonym Clgi Collagenase inhibitor Collagenase inhibitor, Human EPA EPO Erythroid Potentiating Activity Erythroid-potentiating activity Fibroblast collagenase inhibitor FLJ90373 HCI Human Collagenase Inhibitor Metalloproteinase inhibitor 1 Metalloproteinase inhibitor 1 precursor OTTHUMP00000023214 TIMP TIMP 1 TIMP metallopeptidase inhibitor 1 TIMP-1 Timp1 TIMP1 protein TIMP1_HUMAN Tissue Inhibitor of Metalloproteinase 1 Tissue inhibitor of metalloproteinases Tissue inhibitor of metalloproteinases 1 Ttissue inhibitor of metalloproteinase 1 erythroid potentiating activity collagenase inhibitor
Description Recombinant Human TIMP1 Protein was expressed in HEK293. It is a Full length protein
Source HEK293
AA Sequence CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQ ALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCS FVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQ LLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIAVDHHHHHH
Molecular Weight 22 kDa including tags
Purity Greater than 95% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -80°C.
Recently viewed