Recombinant Human TIMM8A/DDP Protein

Beta LifeScience SKU/CAT #: BLA-9010P
Recombinant Human TIMM8A/DDP Protein

Recombinant Human TIMM8A/DDP Protein

Beta LifeScience SKU/CAT #: BLA-9010P
Catalog No.: BLA-9010P

Product Overview

Host Species Human
Accession O60220
Synonym DDP DDP 1 DDP1 Deafness dystonia protein 1 Deafness/dystonia peptide DFN 1 DFN1 MGC12262 Mitochondrial import inner membrane translocase subunit Tim8 A MTS TIM 8A TIM8 TIM8A TIM8A_HUMAN TIMM 8A timm8a Translocase of inner mitochondrial membrane 8 homolog A X linked deafness dystonia protein X-linked deafness dystonia protein
Description Recombinant Human TIMM8A/DDP Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDK PGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD
Molecular Weight 13 kDa including tags
Purity Greater than 90% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed