Recombinant Human TIM 4 Protein (Fc Tag Active)

Beta LifeScience SKU/CAT #: BLA-9007P
Recombinant Human TIM 4 Protein (Fc Tag Active)

Recombinant Human TIM 4 Protein (Fc Tag Active)

Beta LifeScience SKU/CAT #: BLA-9007P
Catalog No.: BLA-9007P

Product Overview

Host Species Human
Accession Q96H15-1
Synonym SMUCKLER Spleen, mucin-containing, knockout of lymphotoxin protein T cell immunoglobulin and mucin domain containing protein 4 T-cell immunoglobulin and mucin domain containing 4 T-cell immunoglobulin and mucin domain containing molecule T-cell immunoglobulin and mucin domain-containing protein 4 T-cell immunoglobulin and mucin domains-containing protein 4 T-cell membrane protein 4 TIM-4 Tim4 TIMD 4 TIMD-4 Timd4 TIMD4_HUMAN
Description Recombinant Human TIM 4 Protein (Fc Tag Active) was expressed in HEK293. It is a Protein fragment
Source HEK293
AA Sequence ETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIRTDGM RVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVK INVRLNLQRASTTTHRTATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTT PDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEATGLLTPEPSKEGPIL TAESETVLPSDSWSSVESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDS VSSPQPGASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQL
Molecular Weight 80 kDa including tags
Purity >98% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated human T cells.
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.
Recently viewed