Recombinant Human TIE2 Protein (Fc Tag)

Beta LifeScience SKU/CAT #: BLA-8998P
Recombinant Human TIE2 Protein (Fc Tag)

Recombinant Human TIE2 Protein (Fc Tag)

Beta LifeScience SKU/CAT #: BLA-8998P
Catalog No.: BLA-8998P

Product Overview

Host Species Human
Accession Q02763
Synonym Angiopoietin 1 receptor Angiopoietin-1 receptor CD202b CD202b antigen Endothelial tyrosine kinase Endothelium specific receptor tyrosine kinase 2 hTIE 2 hTIE2 Hyk p140 TEK Soluble TIE2 variant 1 Soluble TIE2 variant 2 Tek tek tyrosine kinase TEK tyrosine kinase endothelial tek tyrosine kinase, endothelial TIE 2 TIE2 TIE2_HUMAN Tunica interna endothelial cell kinase Tyrosine kinase with Ig and EGF homology domains 2 Tyrosine kinase with Ig and EGF homology domains-2 Tyrosine protein kinase receptor TEK Tyrosine protein kinase receptor TIE 2 Tyrosine-protein kinase receptor TEK Tyrosine-protein kinase receptor TIE-2 Venous malformations multiple cutaneous and mucosal VMCM VMCM 1 VMCM1
Description Recombinant Human TIE2 Protein (Fc Tag) was expressed in Insect cells. It is a Protein fragment
Source Insect cells
AA Sequence AMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPL EVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQA SFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPD ILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNH LCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQE GCKSYVFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEM CDRFQGCLCSPGWQGLQCEREGIQRMTPKIVDLPDHIEVNSGKFNPICKA SGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSGVW VCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFG DGPIKSKKLLYKPVNHYEAWQHIQVTNEIVTLNYLEPRTEYELCVQLVRR GEGGEGHPGPVRRFTTASIGLPPPRGLNLLPKSQTTLNLTWQPIFPSSED DFYVEVERRSVQKSDQQNIKVPGNLTSVLLNNLHPREQYVVRARVNTKAQ GEWSEDLTAWTLSDILPPQPENIKISNITHSSAVISWTILDGYSISSITI RYKVQGKNEDQHVDVKIKNATITQYQLKGLEPETAYQVDIFAENNIGSSN PAFSHELVTRSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVL HQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Purity >90% SDS-PAGE.Source: Insect cells.Purity: > 90%, by SDS-PAGE and visualised by silver stain.Endotoxin level: < 0.1 ng per ug sTIE-2/Fc.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle.
Recently viewed