Recombinant Human TIA1 Protein

Beta LifeScience SKU/CAT #: BLA-8977P
Recombinant Human TIA1 Protein

Recombinant Human TIA1 Protein

Beta LifeScience SKU/CAT #: BLA-8977P
Catalog No.: BLA-8977P

Product Overview

Host Species Human
Accession Q96B58
Synonym Cytotoxic granule associated RNA binding protein Cytotoxic granule associated RNA binding protein 1 mTIA-1 Nucleolysin TIA 1 isoform p40 Nucleolysin TIA-1 isoform p40 Nucleolysin TIA1 isoform p40 p40 TIA 1 p40-TIA-1 p40-TIA-1 (containing p15-TIA-1) RNA binding protein TIA 1 RNA binding protein TIA1 RNA-binding protein TIA-1 T-cell-restricted intracellular antigen-1 Tia TIA 1 TIA 1 cytotoxic granule associated RNA binding protein TIA-1 TIA1 TIA1 cytotoxic granule associated RNA binding protein TIA1 cytotoxic granule associated RNA binding protein like 1 TIA1 protein TIA1_HUMAN TIAL1 TIAR WDM
Description Recombinant Human TIA1 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCF VEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQ RSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYG FVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYECRCIGE EKEMWNFGEKYARF
Molecular Weight 49 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed