Recombinant Human Thyroxine Binding Globulin Protein

Beta LifeScience SKU/CAT #: BLA-8976P
Recombinant Human Thyroxine Binding Globulin Protein

Recombinant Human Thyroxine Binding Globulin Protein

Beta LifeScience SKU/CAT #: BLA-8976P
Catalog No.: BLA-8976P

Product Overview

Host Species Human
Accession P05543
Synonym Serine (or cysteine) proteinase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 7 Serpin A7 Serpin peptidase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 7 Serpin peptidase inhibitor, clade A, member 7 Serpina7 T4 binding globulin TBG TBG, serum THBG_HUMAN Thyroxin binding globulin Thyroxine binding globulin Thyroxine-binding globulin Thyroxine-binding globulin od serum
Description Recombinant Human Thyroxine Binding Globulin Protein was expressed in HEK293. It is a Full length protein
Source HEK293
AA Sequence ASPEGKVTACHSSQPNATLYKMSSINADFAFNLYRRFTVETPDKNIFFSP VSISAALVMLSFGACCSTQTEIVETLGFNLTDTPMVEIQHGFQHLICSLN FPKKELELQIGNALFIGKHLKPLAKFLNDVKTLYETEVFSTDFSNISAAK QEINSHVEMQTKGKVVGLIQDLKPNTIMVLVNYIHFKAQWANPFDPSKTE DSSSFLIDKTTTVQVPMMHQMEQYYHLVDMELNCTVLQMDYSKNALALFV LPKEGQMESVEAAMSSKTLKKWNRLLQKGWVDLFVPKFSISATYDLGATL LKMGIQHAYSENADFSGLTEDNGLKLSNAAHKAVLHIGEKGTEAAAVPEV ELSDQPENTFLHPIIQIDRSFMLLILERSTRSILFLGKVVNPTEAVDHHH HHH
Molecular Weight 45 kDa including tags
Purity >95% SDS-PAGE.Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. The lyo
Recently viewed