Recombinant Human Thrombospondin Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-8961P
Recombinant Human Thrombospondin Protein (His tag)

Recombinant Human Thrombospondin Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-8961P
Catalog No.: BLA-8961P

Product Overview

Host Species Human
Accession P07996
Synonym THBS THBS 1 Thbs1 Thrombospondin 1 Thrombospondin-1 TSP TSP 1 TSP1 TSP1_HUMAN
Description Recombinant Human Thrombospondin Protein (His tag) was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence NRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIP PVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFS VVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLY IDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFV FGTTPEDILRNKGCSSSTSVLLTLDNNVVNGSSPAIRTNYIGHKTKDLQA ICGISCDELSSMVLELRGLRTIVTTLQDSIRKVTEENKELANELRRPPLC YHNGVQYRNNEEWTVDSCTECHCQNS
Molecular Weight 41 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed