Recombinant Human Thrombospondin Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-8961P
Recombinant Human Thrombospondin Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-8961P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P07996 |
Synonym | THBS THBS 1 Thbs1 Thrombospondin 1 Thrombospondin-1 TSP TSP 1 TSP1 TSP1_HUMAN |
Description | Recombinant Human Thrombospondin Protein (His tag) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | NRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIP PVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFS VVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLY IDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFV FGTTPEDILRNKGCSSSTSVLLTLDNNVVNGSSPAIRTNYIGHKTKDLQA ICGISCDELSSMVLELRGLRTIVTTLQDSIRKVTEENKELANELRRPPLC YHNGVQYRNNEEWTVDSCTECHCQNS |
Molecular Weight | 41 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Binds heparin. May play a role in dentinogenesis and/or maintenance of dentin and dental pulp. Ligand for CD36 mediating antiangiogenic properties. Plays a role in ER stress response, via its interaction with the activating transcription factor 6 alpha (ATF6) which produces adaptive ER stress response factors. |
Subcellular Location | Secreted. Cell surface. Secreted, extracellular space, extracellular matrix. Endoplasmic reticulum. Sarcoplasmic reticulum. |
Protein Families | Thrombospondin family |
Database References |
Gene Functions References
- High THBS1 expression is associated with migration, invasion, and progression of bladder cancer. PMID: 29602637
- intracellular dynamics of the TSP1-induced apoptosis signaling pathway PMID: 29258506
- TSP-1 effectively elevated P. gingivalis LPS-induced inflammation mediated by the NF-kappaB pathway and may be critical for pathology of periodontitis. PMID: 28634844
- These findings indicate that PRR13/THBS1 and TXN expression could be used for the prediction of resistance to treatment of epithelial ovarian cancer patients. PMID: 27779244
- TSP-1 appears to play an accessory role in modulating Mp activity in humans and BlaJ mice in a gender, age and muscle-dependent manner, but is unlikely a primary driver of disease progression of dysferlinopathy. PMID: 29206970
- TSP-4 A387P polymorphism, but not TSP-1 polymorphism, is an independent risk factor for acute myocardial infarction in Egyptians. PMID: 29336258
- Results show that the thrombospondin 1 (TSP1) and its receptor CD47 (CD47) axis selectively regulates NADPH oxidase 1 (Nox1) in the regulation of endothelial senescence and suggest potential targets for controlling the aging process at the molecular level. PMID: 29042481
- 15-LOX-1 expression in colon and prostate cancer cells leads to reduced angiogenesis. These changes could be mediated by an increase in the expression of both ICAM-1 and the anti-angiogenic protein TSP-1. PMID: 28757355
- miR-98 can suppress the expression of TSP1 in the peripheral B cells of patients with allergic asthma. PMID: 28760845
- Data indicate correlation between the levels of thrombospondin-1 and overall survival of ovarian cancer patients, suggesting thrombospondin-1 may be used as a prognostic factor in ovarian cancer patients. PMID: 28655131
- Studies show that thrombospondin-1 (Thbs-1), is a prolific contributor to the production and modulation of ROS in large conductance vessels and in the peripheral circulation. Recently, the presence of physiologically relevant circulating Thbs-1 levels was proven to also disrupt vasodilation to nitric oxide (NO) in coronary arterioles from aged animals, negatively impacting coronary blood flow reserve. [review] PMID: 28762749
- Our findings suggest that Rab37-mediated TSP1 secretion in cancer cells suppresses metastasis and angiogenesis via a cross-talk with endothelial cells and reveal a novel component of the vesicular exocytic machinery in tumor microenvironment and tumor progression PMID: 28151721
- TSP-1 strongly potentiated the proliferative and migratory activity of PDGF on mesenchymal stromal cells. PMID: 26992552
- This study demonstrated that THBS! was detected in the serums of Alzheimer disease patients. PMID: 27911324
- Functional studies showed THBS1 and TNC to mediate chemoresistance through the integrin beta1/mTOR pathway. PMID: 27487140
- These findings shed light on the mechanisms leading to beta-cell failure during metabolic stress and point to THBS1 as an interesting therapeutic target to prevent oxidative stress in type 2 diabetes. PMID: 27588705
- Thrombospondin-1 gene polymorphism is associated with estimated pulmonary artery pressure in patients with sickle cell anemia. PMID: 28033687
- High plasma levels of TSP-1 are associated with increased pulmonary arterial pressure, increased pulmonary vascular resistance and decreased survival pulmonary hypertension. PMID: 27473366
- Genetic variants of THBS1 were significantly more frequent in patients affected by idiopathic/genetic generalized epilepsies than in non-epileptic controls. PMID: 28913875
- In pulmonary hypertension TSP1-CD47 is upregulated, and contributes to pulmonary arterial vasculopathy and dysfunction. PMID: 27742621
- High THBS1 expression is associated with primary effusion lymphoma. PMID: 28146424
- KLK4 further liberated an N-terminal product, with purported angiogenic activity, from thrombospondin-1 (TSP1) and cleaved TSP1 in an osteoblast-derived matrix. PMID: 27378148
- Data suggest pituitary cells secrete factor (TSP1) that binds to and inhibits action of BMP2 and BMP4; von Willebrand type C domain of TSP1 is likely responsible for this BMP2/4-binding activity. These studies were initially conducted using cultured cells from ovine pituitary gland and mouse cell line; interactions were confirmed using recombinant human proteins. (TSP1 = thrombospondin-1; BMP = bone morphogenetic protein) PMID: 28747434
- the results obtained by combining bioinformatics and preclinical studies strongly suggest that targeting TSP-1/CD47 axis may represent a valuable therapeutic alternative for hampering melanoma spreading. PMID: 27349907
- The levels of CD36, STAT3 and TGFbetaR2 mRNA were significantly higher in the TSP1-high group. PMID: 28668845
- Study discovered novel and independent associations of prediabetes and related traits with MASP1, and some evidence for associations with THBS1, GPLD1 and ApoA-IV, suggesting a role for these proteins in the pathophysiology of type 2 diabetes. PMID: 27344311
- TSP-1 deficiency promotes maladaptive remodelling of the ECM leading to accelerated abdominal aortic aneurysms progression. PMID: 28364044
- Low THBS1 expression is associated with lung cancer. PMID: 27513329
- FGF7 stimulation of cell invasion and migration was partially suppressed by the FGFR2 knockdown. In addition, FGF7/FGFR2 upregulated THBS1, and cell invasion and migration were decreased by knockdown of THBS1 PMID: 28339036
- Introduces a computational model that describes the mechanistic interactions between intracellular biomolecules and cooperation between signaling pathways that together make up the complex network of TSP-1 regulation both at the transcriptional and post-transcriptional level. PMID: 28045898
- Peg3 Induces Thrombospondin 1 Secretion and Inhibits Capillary Morphogenesis Independently of Beclin 1. PMID: 28174297
- The simulated model of the fully calcium-loaded and calcium-depleted TSP1-Sig1 may enable the development of its interactions as a novel therapeutic target for the treatment of vascular diseases. PMID: 27485292
- Regulatory elements for both IRF-1 (-1019 to -1016) and CREB (-1198 to -1195), specific to the distal THBS1 promoter, were required for leptin-induced TSP-1 transcription. PMID: 27281481
- Competitive inhibition experiments with other pneumococcal hTSP-1 adhesins demonstrated that PspC and PspC-like Hic recognize similar domains, whereas PavB and Hic can bind simultaneously to hTSP-1. PMID: 28209711
- Methylation of DAPK and THBS1 genes occurs in esophageal gastric-type columnar metaplasia and is associated with H. pylori cagA positive infection. PMID: 27182166
- Within the limitations of this study, the results seem to sustain the involvement of Pentraxin 3 and Thrombospondin 1 in the processes of inflammation and angiogenesis in wound healing of patients with postorthodontic gingivectomy. PMID: 27403446
- Circulating TSP-1 levels decrease up to 24 months prior to diagnosis of PDAC and significantly enhance the diagnostic performance of CA19-9. The influence of diabetes mellitus on biomarker behavior should be considered in future studies. PMID: 26573598
- F-actin dynamics modulate the patterning of TSP1 in extracellular matrix and that TSP1 oligomer state is a key determinant of this process. PMID: 26182380
- TSP-1 regulates multiple microRNAs in VSMCs adding a new layer of complexity to TSP-1 regulation of VSMC function PMID: 26728995
- quercetin could increase TSP-1 expression to inhibit angiogenesis resulting in antagonizing prostate cancer PC-3 cell and xenograft tumor growth PMID: 26676551
- The anti-angiogenic activity of the native TSP-1 active fragment was maintained in the new TSP-1 mimetics and the results provide a new chemical approach for the design of TSP-1 mimetics. PMID: 26464514
- In the current study Factor V Leiden, prothrombin G20210A, and thrombospondin-1 polymorphisms showed no association with severity of hepatic fibrosis. PMID: 26768578
- Triptolide can down regulates the expression of thrombospondin 1 and TGF-beta-1 in renal tubular cells. This plays a role in the pathogenesis of renal tubular fibrosis. PMID: 25945607
- increased plasma thrombospondin-1 concentrations following ICH are independently associated with injury severity and short-term and long-term clinical outcomes PMID: 26368265
- Novel role of TNFalpha in inducing inflammatory stress response in human microvascular endothelial cells through Akt- and P38 MAPK-mediated expression of TSP-1, independent of NFkappaB signaling. PMID: 25963668
- Plasma thrombospondin-1 concentrations are elevated obviously and are highly associated with long-term outcome of ischemic stroke PMID: 26296896
- TSP1 up regulation might be critically involved in the disease progression with rheumatoid arthritis. PMID: 25934826
- The THBS1 N700S polymorphism was associated with coronary artery disease risk. PMID: 25976449
- DLL4/Notch1 and BMP9 interdependent signaling induces endothelial cell quiescence via P27KIP1/thrombospondin pathway. PMID: 26471266
- Authors demonstrated that TSP-1 mRNA expression level was significantly upregulated in inflamed periodontitis gingival tissues PMID: 25501558