Recombinant Human Thrombomodulin Protein

Beta LifeScience SKU/CAT #: BLA-8955P
Recombinant Human Thrombomodulin Protein

Recombinant Human Thrombomodulin Protein

Beta LifeScience SKU/CAT #: BLA-8955P
Catalog No.: BLA-8955P

Product Overview

Host Species Human
Accession P07204
Synonym AHUS 6 AHUS6 BDCA 3 BDCA3 CD 141 CD141 CD141 antigen Fetomodulin Thbd THPH12 THRM Thrombomodulin TM TRBM_HUMAN
Description Recombinant Human Thrombomodulin Protein was expressed in HEK293. It is a Protein fragment
Source HEK293
AA Sequence APAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAA DVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTS YSRWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCE FHFPATCRPLAVEPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPL GLQLMCTAPPGAVQGHWAREAPGAWDCSVENGGCEHACNAIPGAPRCQCP AGAALQADGRSCTASATQSCNDLCEHFCVPNPDQPGSYSCMCETGYRLAA DQHRCEDVDDCILEPSPCPQRCVNTQGGFECHCYPNYDLVDGECVEPVDP CFRANCEYQCQPLNQTSYLCVCAEGFAPIPHEPHRCQMFCNQTACPADCD PNTQASCECPEGYILDDGFICTDIDECENGGFCSGVCHNLPGTFECICGP DSALARHIGTDCDSGKVDGGDSGSGEPPPSPTPGSTLTPPA
Molecular Weight 52 kDa
Purity >95% SDS-PAGE.Purity: > 98% by SDS-PAGE gel and HPLC analyses.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Biological Activity :Measured by its ability to activate protein C induced cleavage of the chromogenic substrate, BOC-Asp-Pro Arg-AMC in the presence of thrombin. The specific activity is greater than 500 pmoles/min/ug.
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. The lyo
Recently viewed