Recombinant Human Thioredoxin / TRX Protein

Beta LifeScience SKU/CAT #: BLA-8945P
Recombinant Human Thioredoxin / TRX Protein

Recombinant Human Thioredoxin / TRX Protein

Beta LifeScience SKU/CAT #: BLA-8945P
Catalog No.: BLA-8945P

Product Overview

Host Species Human
Accession P10599-1
Synonym ADF ATL derived factor ATL-derived factor DKFZp686B1993 MGC61975 SASP Surface associated sulphydryl protein Surface-associated sulphydryl protein testicular tissue protein Li 199 THIO_HUMAN Thioredoxin thioredoxin delta 3 TRDX Trx TRX 1 TRX1 TXN TXN delta 3 TXN protein zgc:92903
Description Recombinant Human Thioredoxin / TRX Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMVKQIESKTAFQEALDAAGDKLVVVDFSAT WCGPCKMIKPFFHSL SEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKE KLEATINELV
Molecular Weight 12 kDa
Purity >95% SDS-PAGE.Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed