Recombinant Human TGT Protein

Beta LifeScience SKU/CAT #: BLA-8933P
Recombinant Human TGT Protein

Recombinant Human TGT Protein

Beta LifeScience SKU/CAT #: BLA-8933P
Catalog No.: BLA-8933P

Product Overview

Host Species Human
Accession Q9BXR0
Synonym FP3235 Guanine insertion enzyme qtrt1 Queuine tRNA ribosyltransferase Queuine tRNA ribosyltransferase 1 Queuine tRNA-ribosyltransferase TGT TGT, 43 KD subunit TGT, catalytic subunit TGT_HUMAN TGUT tRNA guanine transglycosylase tRNA-guanine transglycosylase
Description Recombinant Human TGT Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGSEFMAGAATQASLESAPRIMRLVAECSR SRARAGELWLPHGTVATPVFMPVGTQATMKGITTEQLDALGCRICLGNTY HLGLRPGPELIQKANGLHGFMNWPHNLLTDSGGFQMVSLVSLSEVTEEGV RFRSPYDGNETLLSPEKSVQIQNALGSDIIMQLDDVVSSTVTGPRVEEAM YRSIRWLDRCIAAHQRPDKQNLFAIIQGGLDADLRATCLEEMTKRDVPGF AIGGLSGGESKSQFWRMVALSTSRLPKDKPRYLMGVGYATDLVVCVALGC DMFDCVFPTRTARFGSALVPTGNLQLRKKVFEKDFGPIDPECTCPTCQKH SRAFLHALLHSDNTAALHHLTVHNIAYQLQLMSAVRTSIVEKRFPDFVRD FMGAMYGDPTLCPTWATDALASVGITLG
Molecular Weight 47 kDa including tags
Purity >80% purity as determined by SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed