Recombinant Human TFIIS Protein

Beta LifeScience SKU/CAT #: BLA-8922P
Recombinant Human TFIIS Protein

Recombinant Human TFIIS Protein

Beta LifeScience SKU/CAT #: BLA-8922P
Catalog No.: BLA-8922P

Product Overview

Host Species Human
Accession Q15560
Synonym Tcea2 TCEA2_HUMAN Testis specific S II Testis-specific S-II TFIIS Transcription elongation factor A (SII) 2 Transcription elongation factor A 2 Transcription elongation factor A protein 2 Transcription elongation factor S II protein 2 Transcription elongation factor S-II protein 2 Transcription elongation factor TFIIS.1 Transcription elongation factor TFIIS.l
Description Recombinant Human TFIIS Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGSMMGKEEEIARIARRLDKMVTKKSAEGA MDLLRELKAMPITLHLLQSTRVGMSVNALRKQSSDEEVIALAKSLIKSWK KLLDASDAKARERGRGMPLPTSSRDASEAPDPSRKRPELPRAPSTPRITT FPPVPVTCDAVRNKCREMLTAALQTDHDHVAIGADCERLSAQIEECIFRD VGNTDMKYKNRVRSRISNLKDAKNPDLRRNVLCGAITPQQIAVMTSEEMA SDELKEIRKAMTKEAIREHQMARTGGTQTDLFTCGKCRKKNCTYTQVQTR SSDEPMTTFVVCNECGNRWKFC
Molecular Weight 36 kDa including tags
Purity Greater than 85% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed