Recombinant Human TFF2 Protein

Beta LifeScience SKU/CAT #: BLA-8915P
Recombinant Human TFF2 Protein

Recombinant Human TFF2 Protein

Beta LifeScience SKU/CAT #: BLA-8915P
Catalog No.: BLA-8915P

Product Overview

Host Species Human
Accession Q03403
Synonym SML 1 SML1 SP Spasmolysin Spasmolytic polypeptide spasmolytic protein 1 TFF 2 TFF2 TFF2_HUMAN Trefoil factor 2 trefoil factor 2 (spasmolytic protein 1) Trefoil factor 2 precursor
Description Recombinant Human TFF2 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence EKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPL PKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKS VEDCHY
Molecular Weight 12 kDa
Purity >97% SDS-PAGE.>97% as determined by SDS-PAGE and HPLC.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human MCF-7 cells is less than 10 ng/ml, corresponding to a specific activity of >1.0x105 IU/mg.
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed