Recombinant Human TEX264 Protein

Beta LifeScience SKU/CAT #: BLA-8907P
Recombinant Human TEX264 Protein

Recombinant Human TEX264 Protein

Beta LifeScience SKU/CAT #: BLA-8907P
Catalog No.: BLA-8907P

Product Overview

Host Species Human
Synonym Putative secreted protein ZSIG11 Secreted protein ZSIG11 SIG11 TEG 264 testis expressed 264 testis expressed gene 264 Testis expressed sequence 264 Testis expressed sequence 264 protein TEX264 ZSIG11
Description Recombinant Human TEX264 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MSDLLLLGLIGGLTLLLLLTLLAFAGYSGLLAGVEVSAGSPPIRNVTVAY KFHMGLYGETGRLFTESCSISPKLRSIAVYYDNPHMVPPDKCRCAVGSIL SEGEESPSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTTILSIWLATRR VHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYVPEMKETEW KWRGLVEAIDTQVDGTGADTMSDTSSVSLEVSPGSRETSAATLSPGASSR GWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTK WLWEPTAPEKGKE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed