Recombinant Human TET3 Protein

Beta LifeScience SKU/CAT #: BLA-8901P
Recombinant Human TET3 Protein

Recombinant Human TET3 Protein

Beta LifeScience SKU/CAT #: BLA-8901P
Catalog No.: BLA-8901P

Product Overview

Host Species Human
Accession O43151
Synonym hCG_40738 KIAA0401 Methylcytosine dioxygenase TET3 Probable methylcytosine dioxygenase TET3 Tet methylcytosine dioxygenase 3 Tet oncogene family member 3 Tet3 TET3_HUMAN
Description Recombinant Human TET3 Protein was expressed in Baculovirus infected Sf9 cells. It is a Protein fragment
Source Baculovirus infected Sf9 cells
AA Sequence MEERYGEKGKAIRIEKVIYTGKEGKSSRGCPIAKWVIRRHTLEEKLLCLV RHRAGHHCQNAVIVILILAWEGIPRSLGDTLYQELTDTLRKYGNPTSRRC GLNDDRTCACQGKDPNTCGASFSFGCSWSMYFNGCKYARSKTPRKFRLAG DNPKEEEVLRKSFQDLATEVAPLYKRLAPQAYQNQVTNEEIAIDCRLGLK EGRPFAGVTACMDFCAHAHKDQHNLYNGCTVVCTLTKEDNRCVGKIPEDE QLHVLPLYKMANTDEFGSEENQNAKVGSGAIQVLTAFPREVRRLPEPAKS CRQRQLEARKAAAEKKKIQKEKLSTPEKIKQEALELAGITSDPGLSLKGG LSQQGLKPSLKVEPQNHFSSFKYSGNAVVESYSVLGNCRPSDPYSMNSVY SYHSYYAQPSLTSVNGFHSKYALPSFSYYGFPSSNPVFPSQFLGPGAWGH SGSSGSFEKKPDLHALHNSLSPAYGGAEFAELPSQAVPTDAHHPTPHHQQ PAYPGPKEYLLPKAPLLHSVSRDPSPFAQSSNCYNRSIKQEPVDPLTQAE PVPRDAGKMGKTPLSEVSQNGGPSHLWGQYSGGPSMSPKRTNGVGGSWGV FSSGESPAIVPDKLSSFGASCLAPSHFTDGQWGLFPGEGQQAASHSGGRL RGKPWSPCKFGNSTSALAGPSLTEKPWALGAGDFNSALKGSPGFQDKLWN PMKGEEGRIPAAGASQLDRAWQSFGLPLGSSEKLFGALKSEEKLWDPFSL EEGPAEEPPSKGAVKEEKGGGGAEEEEEELWSDSEHNFLDENIGGVAVAP AHGSILIECARRELHATTPLKKPNRCHPTRISLVFYQHKNLNQPNHGLAL WEAKMKQLAERARARQEEAARLGLGQQEAKLYGKKRKWGGTVVAEPQQKE KKGVVPTRQALAVPTDSAVTVSSYAYTKVTGPYSRWI
Molecular Weight 102 kDa
Purity >70% Densitometry.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed