Recombinant Human TESK2 Protein

Beta LifeScience SKU/CAT #: BLA-8895P
Recombinant Human TESK2 Protein

Recombinant Human TESK2 Protein

Beta LifeScience SKU/CAT #: BLA-8895P
Catalog No.: BLA-8895P

Product Overview

Host Species Human
Accession Q96S53
Synonym Dual specificity testis specific protein kinase 2 Dual specificity testis-specific protein kinase 2 MGC29168 OTTHUMP00000009093 RP23-109A3.2 Tesk2 TESK2_HUMAN Testicular protein kinase 2 Testis specific kinase 2
Description Recombinant Human TESK2 Protein was expressed in Baculovirus infected Sf9 cells. It is a Full length protein
Source Baculovirus infected Sf9 cells
AA Sequence MDRSKRNSIAGFPPRVERLEEFEGGGGGEGNVSQVGRVWPSSYRALISAF SRLTRLDDFTCEKIGSGFFSEVFKVRHRASGQVMALKMNTLSSNRANMLK EVQLMNRLSHPNILRFMGVCVHQGQLHALTEYINSGNLEQLLDSNLHLPW TVRVKLAYDIAVGLSYLHFKGIFHRDLTSKNCLIKRDENGYSAVVADFGL AEKIPDVSMGSEKLAVVGSPFWMAPEVLRDEPYNEKADVFSYGIILCEII ARIQADPDYLPRTENFGLDYDAFQHMVGDCPPDFLQLTFNCCNMDPKLRP SFVEIGKTLEEILSRLQEEEQERDRKLQPTARGLLEKAPGVKRLSSLDDK IPHKSPCPRRTIWLSRSQSDIFSRKPPRTVSVLDPYYRPRDGAARTPKVN PFSARQDLMGGKIKFFDLPSKSVISLVFDLDAPGPGTMPLADWQEPLAPP IRRWRSLPGSPEFLHQEACPFVGREESLSDGPPPRLSSLKYRVKEIPPFR ASALPAAQAHEAMDCSILQEENGFGSRPQGTSPCPAGASEEMEVEERPAG STPATFSTSGIGLQTQGKQDG
Molecular Weight 92 kDa including tags
Purity >80% Densitometry.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity The specific activity of this recombinant protein was determined to be 3.5 nmol/min/mg.
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed