Recombinant Human TERP Protein
Beta LifeScience
SKU/CAT #: BLA-8893P
Recombinant Human TERP Protein
Beta LifeScience
SKU/CAT #: BLA-8893P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9BY49 |
Synonym | 2 2 4 dienoyl CoA reductase related protein 4-dienoyl-CoA reductase-related protein DCR RP DCR-RP DCRRP HPDHase HSA250303 OTTHUMP00000206786 PECR PECR_HUMAN Peroxisomal trans 2 enoyl CoA reductase Peroxisomal trans-2-enoyl-CoA reductase PRO1004 Putative short chain alcohol dehydrogenase pVI ARL pVI-ARL PVIARL SDR29C1 Short chain dehydrogenase/reductase family 29C member 1 TERP |
Description | Recombinant Human TERP Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMASWAKGRSYLAPGLLQGQVAIVTGG ATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTKQARVIP IQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHA VLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARA GVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSWGQSFFEGSFQ KIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPD HDNWPKGAGDLSVVKKMKETFKEKAKL |
Molecular Weight | 35 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |