Recombinant Human TERP Protein

Beta LifeScience SKU/CAT #: BLA-8893P
Recombinant Human TERP Protein

Recombinant Human TERP Protein

Beta LifeScience SKU/CAT #: BLA-8893P
Catalog No.: BLA-8893P

Product Overview

Host Species Human
Accession Q9BY49
Synonym 2 2 4 dienoyl CoA reductase related protein 4-dienoyl-CoA reductase-related protein DCR RP DCR-RP DCRRP HPDHase HSA250303 OTTHUMP00000206786 PECR PECR_HUMAN Peroxisomal trans 2 enoyl CoA reductase Peroxisomal trans-2-enoyl-CoA reductase PRO1004 Putative short chain alcohol dehydrogenase pVI ARL pVI-ARL PVIARL SDR29C1 Short chain dehydrogenase/reductase family 29C member 1 TERP
Description Recombinant Human TERP Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGSHMASWAKGRSYLAPGLLQGQVAIVTGG ATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTKQARVIP IQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHA VLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARA GVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSWGQSFFEGSFQ KIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPD HDNWPKGAGDLSVVKKMKETFKEKAKL
Molecular Weight 35 kDa including tags
Purity Greater than 95% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed