Recombinant Human TEF1/TEAD-1 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-8885P
Recombinant Human TEF1/TEAD-1 Protein (His tag)

Recombinant Human TEF1/TEAD-1 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-8885P
Catalog No.: BLA-8885P

Product Overview

Host Species Human
Accession P28347-1
Synonym AA Atrophia areata peripapillary chorioretinal degeneration NTEF 1 NTEF-1 NTEF1 Protein GT IIC Protein GT-IIC REF 1 REF1 SV40 transcriptional enhancer factor TCF 13 TCF-13 TCF13 TEA domain family member TEA domain family member 1 TEA domain family member 1 (SV40 transcriptional enhancer factor) TEAD 1 TEAD 1 protein TEAD-1 TEAD1 TEAD1 protein TEAD1_HUMAN TEF 1 TEF1 Transcription factor 13 Transcription factor 13 (SV40 transcriptional enhancer factor) Transcriptional enhancer factor 1 Transcriptional enhancer factor TEF-1 Transcriptional enhancer factor TEF1
Description Recombinant Human TEF1/TEAD-1 Protein (His tag) was expressed in Yeast. It is a Full length protein
Source Yeast
AA Sequence MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIY PPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARR KSRDFHSKLKDQTAKDKALQHMAAMSSAQIVSATAIHNKLGLPGIPRPTF PGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPA PSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGHANHSYS DPLLESVDIRQIYDKFPEKKGGLKELFGKGPQNAFFLVKFWADLNCNIQD DAGAFYGVTSQYESSENMTVTCSTKVCSFGKQVVEKVETEYARFENGRFV YRINRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILLVVTNRDTQETL LCMACVFEVSNSEHGAQHHIYRLVKD
Molecular Weight 50 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed