Recombinant Human TDP2 Protein
Beta LifeScience
SKU/CAT #: BLA-8872P
Recombinant Human TDP2 Protein
Beta LifeScience
SKU/CAT #: BLA-8872P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | O95551 |
Synonym | 5'-Tyr-DNA phosphodiesterase 5'-tyrosyl-DNA phosphodiesterase AD 022 AD022 dJ30M3.3 EAP 2 EAP II EAP2 EAPII ETS 1 associated protein 2 ETS 1 associated protein II ETS1 associated protein 2 ETS1 associated protein II ETS1-associated protein 2 ETS1-associated protein II MGC111021 MGC9099 RP1-30M3.3 tdp2 TRAF and TNF receptor associated protein TRAF and TNF receptor-associated protein TTRAP TYDP2_HUMAN Tyr DNA phosphodiesterase 2 Tyr-DNA phosphodiesterase 2 Tyrosyl DNA phosphodiesterase 2 Tyrosyl-DNA phosphodiesterase 2 |
Description | Recombinant Human TDP2 Protein was expressed in Baculovirus infected Sf9 cells. It is a Full length protein |
Source | Baculovirus infected Sf9 cells |
AA Sequence | MELGSCLEGGREAAEEEGEPEVKKRRLLCVEFASVASCDAAVAQCFLAEN DWEMERALNSYFEPPVEESALERRPETISEPKTYVDLTNEETTDSTTSKI SPSEDTQQENGSMFSLITWNIDGLDLNNLSERARGVCSYLALYSPDVIFL QEVIPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFP STKMMRNLLCVHVNVSGNELCLMTSHLESTRGHAAERMNQLKMVLKKMQE APESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQ MNSNLGITAACKLRFDRIFFRAAAEEGHIIPRSLDLLGLEKLDCGRFPSD HWGLLCNLDIIL |
Molecular Weight | 67 kDa including tags |
Purity | >= 85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Specific activity of this recombinant protein was determined to be 186 pmol/min/µg. Enzyme reaction was performed in a reaction buffer (200 µl) containing 50 mM Tris (pH 7.4), 1 mM MgCl2, 50 mM KCl, 1 mM DTT, 0.1 mg/ml BSA, 2 mM T5PNP and TDP2. Reaction was continuously monitored at 415 nm for 20 min. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |