Recombinant Human TDP2 Protein

Beta LifeScience SKU/CAT #: BLA-8872P
Recombinant Human TDP2 Protein

Recombinant Human TDP2 Protein

Beta LifeScience SKU/CAT #: BLA-8872P
Catalog No.: BLA-8872P

Product Overview

Host Species Human
Accession O95551
Synonym 5'-Tyr-DNA phosphodiesterase 5'-tyrosyl-DNA phosphodiesterase AD 022 AD022 dJ30M3.3 EAP 2 EAP II EAP2 EAPII ETS 1 associated protein 2 ETS 1 associated protein II ETS1 associated protein 2 ETS1 associated protein II ETS1-associated protein 2 ETS1-associated protein II MGC111021 MGC9099 RP1-30M3.3 tdp2 TRAF and TNF receptor associated protein TRAF and TNF receptor-associated protein TTRAP TYDP2_HUMAN Tyr DNA phosphodiesterase 2 Tyr-DNA phosphodiesterase 2 Tyrosyl DNA phosphodiesterase 2 Tyrosyl-DNA phosphodiesterase 2
Description Recombinant Human TDP2 Protein was expressed in Baculovirus infected Sf9 cells. It is a Full length protein
Source Baculovirus infected Sf9 cells
AA Sequence MELGSCLEGGREAAEEEGEPEVKKRRLLCVEFASVASCDAAVAQCFLAEN DWEMERALNSYFEPPVEESALERRPETISEPKTYVDLTNEETTDSTTSKI SPSEDTQQENGSMFSLITWNIDGLDLNNLSERARGVCSYLALYSPDVIFL QEVIPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFP STKMMRNLLCVHVNVSGNELCLMTSHLESTRGHAAERMNQLKMVLKKMQE APESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQ MNSNLGITAACKLRFDRIFFRAAAEEGHIIPRSLDLLGLEKLDCGRFPSD HWGLLCNLDIIL
Molecular Weight 67 kDa including tags
Purity >= 85% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Specific activity of this recombinant protein was determined to be 186 pmol/min/µg. Enzyme reaction was performed in a reaction buffer (200 µl) containing 50 mM Tris (pH 7.4), 1 mM MgCl2, 50 mM KCl, 1 mM DTT, 0.1 mg/ml BSA, 2 mM T5PNP and TDP2. Reaction was continuously monitored at 415 nm for 20 min.
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed