Recombinant Human TC1 Protein

Beta LifeScience SKU/CAT #: BLA-8797P
Recombinant Human TC1 Protein

Recombinant Human TC1 Protein

Beta LifeScience SKU/CAT #: BLA-8797P
Catalog No.: BLA-8797P

Product Overview

Host Species Human
Synonym S19A2_HUMAN SLC19A2 Solute carrier family 19 member 2 TC1 Thiamine carrier 1 Thiamine transporter 1 THT1 ThTr 1 ThTr-1 ThTr1 TRMA
Description Recombinant Human TC1 Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence PMPQKSLFFHHIPSTCQRVNGIKVQNGGIVTDTPASNHLPGWEDIESKIP LNMEEPPVEEPEPKPDRLLVLKVLWND
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed