Recombinant Human TBX5 Protein

Beta LifeScience SKU/CAT #: BLA-8796P
Recombinant Human TBX5 Protein

Recombinant Human TBX5 Protein

Beta LifeScience SKU/CAT #: BLA-8796P
Catalog No.: BLA-8796P

Product Overview

Host Species Human
Accession Q99593
Synonym Holt Oram syndrome HOS T box 5 T box protein 5 T box transcription factor TBX 5 T box transcription factor TBX5 T-box protein 5 T-box transcription factor TBX5 TBX 5 TBX5 TBX5_HUMAN Transcription factor T box 5
Description Recombinant Human TBX5 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MADADEGFGLAHTPLEPDAKDLPCDSKPESALGAPSKSPSSPQAAFTQQG MEGIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKY ILLMDIVPADDHRYKFADNKWSVTGKAEPAMPGRLYVHPDSPATGAHWMR QLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTA FCTHVFPETAFIAVTSYQNHKITQLKIENNPFAKGFRGSDDMELHRMSRM QSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENGVSGP SQDLLPPPNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEE DSFYRSSYPQQQGLGASYRTESAQRQACMYASSAPPSEPVPSLEDISCNT WPSMPSYSSCTVTTVQPMDRLPYQHFSAHFTSGPLVPRLAGMANHGSPQL GEGMFQHQTSVAHQPVVRQCGPQTGLQSPGTLQPPEFLYSHGVPRTLSPH QYHSVHGVGMVPEWSDNS
Molecular Weight 84 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed