Recombinant Human Tbx2 Protein

Beta LifeScience SKU/CAT #: BLA-8794P
Recombinant Human Tbx2 Protein

Recombinant Human Tbx2 Protein

Beta LifeScience SKU/CAT #: BLA-8794P
Catalog No.: BLA-8794P

Product Overview

Host Species Human
Synonym FLJ10169 HGNC:11597 T box 2 T box transcription factor TBX2 T-box protein 2 T-box transcription factor TBX2 TBX2 TBX2_HUMAN
Description Recombinant Human Tbx2 Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence GSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAGGNSREPSPLPEL ALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGLESQRALSPGRESPK
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed