Recombinant Human TBLR1/TBL1XR1 Protein
Beta LifeScience
SKU/CAT #: BLA-8790P
Recombinant Human TBLR1/TBL1XR1 Protein
Beta LifeScience
SKU/CAT #: BLA-8790P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | C21 DC42 F box like/WD repeat containing protein TBL1XR1 F-box-like/WD repeat-containing protein TBL1XR1 FLJ12894 IRA1 Nuclear receptor corepressor/HDAC3 complex subunit Nuclear receptor corepressor/HDAC3 complex subunit TBLR1 TBL1 related protein 1 TBL1-related protein 1 TBL1R_HUMAN TBL1XR1 TBLR1 Transducin (beta) like 1 X linked receptor 1 Transducin beta like 1X related protein 1 Transducin beta-like 1X-related protein 1 |
Description | Recombinant Human TBLR1/TBL1XR1 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MQRYNFHYLKYIVHFYRTCDYSRMIRMVLAYGELLLLTVSAEILFQWTNI VAWQQMPTFCGIAANLQETLVGFSFCFLCFFPLLLNQQGWKEGREVMNYS FQ |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |