Recombinant Human TBLR1/TBL1XR1 Protein

Beta LifeScience SKU/CAT #: BLA-8790P
Recombinant Human TBLR1/TBL1XR1 Protein

Recombinant Human TBLR1/TBL1XR1 Protein

Beta LifeScience SKU/CAT #: BLA-8790P
Catalog No.: BLA-8790P

Product Overview

Host Species Human
Synonym C21 DC42 F box like/WD repeat containing protein TBL1XR1 F-box-like/WD repeat-containing protein TBL1XR1 FLJ12894 IRA1 Nuclear receptor corepressor/HDAC3 complex subunit Nuclear receptor corepressor/HDAC3 complex subunit TBLR1 TBL1 related protein 1 TBL1-related protein 1 TBL1R_HUMAN TBL1XR1 TBLR1 Transducin (beta) like 1 X linked receptor 1 Transducin beta like 1X related protein 1 Transducin beta-like 1X-related protein 1
Description Recombinant Human TBLR1/TBL1XR1 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MQRYNFHYLKYIVHFYRTCDYSRMIRMVLAYGELLLLTVSAEILFQWTNI VAWQQMPTFCGIAANLQETLVGFSFCFLCFFPLLLNQQGWKEGREVMNYS FQ
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed