Recombinant Human TAZ Protein
Beta LifeScience
SKU/CAT #: BLA-8784P
Recombinant Human TAZ Protein
Beta LifeScience
SKU/CAT #: BLA-8784P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | DKFZP586I1419 FLJ27004 FLJ45718 OTTHUMP00000215994 OTTHUMP00000215995 OTTHUMP00000215996 OTTHUMP00000216001 TAZ Transcriptional co activator with PDZ binding motif Transcriptional coactivator with PDZ binding motif Transcriptional coactivator with PDZ-binding motif WW domain containing transcription regulator 1 WW domain containing transcription regulator protein 1 WW domain-containing transcription regulator protein 1 WWTR 1 WWTR1 WWTR1_HUMAN |
Description | Recombinant Human TAZ Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPE SFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGA GAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKIT TWQDPRKAMNQPLNHMNLHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMA PSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMR QEELMRQEAALCRQLPMEAETLAPVQAAVNPPTMTPDMRSITNNSSDPFL NGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNI NPQQTRFPDFLDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |