Recombinant Human TAZ Protein

Beta LifeScience SKU/CAT #: BLA-8784P
Recombinant Human TAZ Protein

Recombinant Human TAZ Protein

Beta LifeScience SKU/CAT #: BLA-8784P
Catalog No.: BLA-8784P

Product Overview

Host Species Human
Synonym DKFZP586I1419 FLJ27004 FLJ45718 OTTHUMP00000215994 OTTHUMP00000215995 OTTHUMP00000215996 OTTHUMP00000216001 TAZ Transcriptional co activator with PDZ binding motif Transcriptional coactivator with PDZ binding motif Transcriptional coactivator with PDZ-binding motif WW domain containing transcription regulator 1 WW domain containing transcription regulator protein 1 WW domain-containing transcription regulator protein 1 WWTR 1 WWTR1 WWTR1_HUMAN
Description Recombinant Human TAZ Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPE SFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGA GAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKIT TWQDPRKAMNQPLNHMNLHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMA PSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMR QEELMRQEAALCRQLPMEAETLAPVQAAVNPPTMTPDMRSITNNSSDPFL NGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNI NPQQTRFPDFLDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed