Recombinant Human Tau Protein

Beta LifeScience SKU/CAT #: BLA-8757P
Recombinant Human Tau Protein

Recombinant Human Tau Protein

Beta LifeScience SKU/CAT #: BLA-8757P
Catalog No.: BLA-8757P

Product Overview

Host Species Human
Accession P10636-8
Synonym AI413597 AW045860 DDPAC FLJ31424 FTDP 17 G protein beta1/gamma2 subunit interacting factor 1 MAPT MAPTL MGC134287 MGC138549 MGC156663 Microtubule associated protein tau Microtubule associated protein tau isoform 4 Microtubule-associated protein tau MSTD Mtapt MTBT1 MTBT2 Neurofibrillary tangle protein Paired helical filament tau Paired helical filament-tau PHF tau PHF-tau PPND PPP1R103 Protein phosphatase 1, regulatory subunit 103 pTau RNPTAU TAU TAU_HUMAN Tauopathy and respiratory failure Tauopathy and respiratory failure, included
Description Recombinant Human Tau Protein was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQT PTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEG TTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTK IATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSP GSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPM PDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHV PGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRV QSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAE
Molecular Weight 41 kDa
Purity >95% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed