Recombinant Human TAP1 Protein

Beta LifeScience SKU/CAT #: BLA-8716P
Recombinant Human TAP1 Protein

Recombinant Human TAP1 Protein

Beta LifeScience SKU/CAT #: BLA-8716P
Catalog No.: BLA-8716P

Product Overview

Host Species Human
Synonym ABC 17 ABC transporter MHC 1 ABC17 ABCB 2 ABCB2 Antigen peptide transporter 1 APT 1 APT1 ATP binding cassette sub family B (MDR/TAP) member 2 ATP binding cassette sub family B member 2 ATP binding cassette transporter ATP-binding cassette sub-family B member 2 D6S114E FLJ26666 FLJ41500 Peptide supply factor 1 Peptide transporter involved in antigen processing 1 Peptide transporter PSF 1 Peptide transporter PSF1 Peptide transporter TAP 1 Peptide transporter TAP1 PSF 1 PSF-1 PSF1 Really interesting new gene 4 protein RING 4 RING4 TAP 1 TAP1 TAP1*0102N TAP1_HUMAN TAP1N Transporter 1 ATP binding cassette sub family B Transporter 1 ATP binding cassette sub family B (MDR/TAP) Transporter associated with antigen processing Transporter ATP binding cassette major histocompatibility complex 1 Y3
Description Recombinant Human TAP1 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MAELLASAGSACSWDFPRAPPSFPPPAASRGGLGGTRSFRPHRGAESPRP GRDRDGVRVPMASSRCPAPRGCRCLPGASLAWLGTVLLLLADWVLLRTAL PRIFSLLVPTALPLLRVWAVGLSRWAVLWLGACGVLRATVGSKSENAGAQ GWLAALKPLAAALGLALPGLALFRELISWGAPGSADSTRLLHWGSHPTAF VVSYAAALPAAALWHKLGSLWVPGGQGGSGNPVRRLLGCLGSETRRLSLF LVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMSILTIASAV LEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTE DTSTLSDSLSENLSLFLWYLVRGLCLLGIMLWGSVSLTMVTLITLPLLFL LPKKVGKWYQLLEVQVRESLAKSSQVAIEALSAMPTVRSFANEEGEAQKF REKLQEIKTLNQKEAVAYAVNSWTTSISGMLLKVGILYIGGQLVTSGAVS SGNLVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPP SGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPN GSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQV FGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAG SQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPE RYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMV QAPADAPE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed