Recombinant Human Tankyrase Protein

Beta LifeScience SKU/CAT #: BLA-8713P
Recombinant Human Tankyrase Protein

Recombinant Human Tankyrase Protein

Beta LifeScience SKU/CAT #: BLA-8713P
Catalog No.: BLA-8713P

Product Overview

Host Species Human
Accession O95271
Synonym ADP-ribosyltransferase diphtheria toxin-like 5 OTTHUMP00000115550 OTTHUMP00000224675 PARP 5a PARP5A PARPL pART5 Poly [ADP-ribose] polymerase 5A TANK 1 TANK1 Tankyrase 1 Tankyrase I Tankyrase TRF1 interacting ankyrin related ADP ribose polymerase Tankyrase-1 Tankyrase1 TankyraseI TIN 1 TIN1 TINF 1 TINF1 TNKS TNKS 1 TNKS-1 TNKS1 TNKS1_HUMAN TRF1 interacting ankyrin related ADP ribose polymerase TRF1-interacting ankyrin-related ADP-ribose polymerase
Description Recombinant Human Tankyrase Protein was expressed in Baculovirus infected Sf9 cells. It is a Protein fragment
Source Baculovirus infected Sf9 cells
AA Sequence ELAVGGASNAGDGAAGTERKEGEVAGLDMNISQFLKSLGLEHLRDIFETE QITLDVLADMGHEELKEIGINAYGHRHKLIKGVERLLGGQQGTNPYLTFH CVNQGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRI QKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDER HAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQML FCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQA YPEYLITYQIMKPEAPSQTATAAEQKT
Molecular Weight 63 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity One unit of PARP incorporates 100 pmoles of poly(ADP) in 1 minute from NAD into the acid-insoluble form.
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed