Recombinant Human Tankyrase Protein
Beta LifeScience
SKU/CAT #: BLA-8713P
Recombinant Human Tankyrase Protein
Beta LifeScience
SKU/CAT #: BLA-8713P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | O95271 |
Synonym | ADP-ribosyltransferase diphtheria toxin-like 5 OTTHUMP00000115550 OTTHUMP00000224675 PARP 5a PARP5A PARPL pART5 Poly [ADP-ribose] polymerase 5A TANK 1 TANK1 Tankyrase 1 Tankyrase I Tankyrase TRF1 interacting ankyrin related ADP ribose polymerase Tankyrase-1 Tankyrase1 TankyraseI TIN 1 TIN1 TINF 1 TINF1 TNKS TNKS 1 TNKS-1 TNKS1 TNKS1_HUMAN TRF1 interacting ankyrin related ADP ribose polymerase TRF1-interacting ankyrin-related ADP-ribose polymerase |
Description | Recombinant Human Tankyrase Protein was expressed in Baculovirus infected Sf9 cells. It is a Protein fragment |
Source | Baculovirus infected Sf9 cells |
AA Sequence | ELAVGGASNAGDGAAGTERKEGEVAGLDMNISQFLKSLGLEHLRDIFETE QITLDVLADMGHEELKEIGINAYGHRHKLIKGVERLLGGQQGTNPYLTFH CVNQGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRI QKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDER HAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQML FCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQA YPEYLITYQIMKPEAPSQTATAAEQKT |
Molecular Weight | 63 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | One unit of PARP incorporates 100 pmoles of poly(ADP) in 1 minute from NAD into the acid-insoluble form. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. |