Recombinant Human TAK1 Protein

Beta LifeScience SKU/CAT #: BLA-8709P
Recombinant Human TAK1 Protein

Recombinant Human TAK1 Protein

Beta LifeScience SKU/CAT #: BLA-8709P
Catalog No.: BLA-8709P

Product Overview

Host Species Human
Accession O43318-2
Synonym M3K7_HUMAN MAP3K 7 Map3k7 MEKK7 Mitogen activated protein kinase kinase kinase 7 Mitogen-activated protein kinase kinase kinase 7 TAK1 TGF beta activated kinase 1 TGF-beta-activated kinase 1 TGF1a Transforming growth factor beta activated kinase 1 Transforming growth factor-beta-activated kinase 1
Description Recombinant Human TAK1 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVV CKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPV CLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPK ALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHMTNNKGSAAWMAPEV FEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPP LIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLES KLLKNQAKQQSESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIA ATTGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTR SHPWTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHC KMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDE NKSLSTYYQQCKKQLEVIRSQQQKRQGTS
Molecular Weight 89 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed