Recombinant Human T-bet / Tbx21 Protein

Beta LifeScience SKU/CAT #: BLA-8789P
Recombinant Human T-bet / Tbx21 Protein

Recombinant Human T-bet / Tbx21 Protein

Beta LifeScience SKU/CAT #: BLA-8789P
Catalog No.: BLA-8789P

Product Overview

Host Species Human
Accession Q9UL17
Synonym T bet T box 21 T box expressed in T cells T box protein 21 T box transcription factor TBX21 T cell specific T box transcription factor T cell specific T box transcription factor T bet T PET T-box protein 21 T-box transcription factor TBX21 T-cell-specific T-box transcription factor T-bet TBET TBLYM TBX 21 Tbx21 TBX21_HUMAN TPET Transcription factor TBLYM
Description Recombinant Human T-bet / Tbx21 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MASMTGGQQMGRGHHHHHHGNLYFQGGEFGIVEPGCGDMLTGTEPMPGSD EGRAPGADPQHRYFYPEPGAQDADERRGGGSLGSPYPGGALVPAPPSRFL GAYAYPPRPQAAGFPGAGESFPPPADAEGYQPGEGYAAPDPRAGLYPGPR EDYALPAGLEVSGKLRVALNNHLLWSKFNQHQTEMIITKQGRRMFPFLSF TVAGLEPTSHYRMFVDVVLVDQHHWRYQSGKWVQCGKAEGSMPGNRLYVH PDSPNTGAHWMRQEVSFGKLKLTNNKGASNNVTQMIVLQSLHKYQPRLHI VEVNDGEPEAACNASNTHIFTFQETQFIAVTAYQNAEITQLKIDNNPFAK GFRENFESMYTSVDTSIPSPPGPNCQFLGGDHYSPLLPNQYPVPSRFYPD LPGQAKDVVPQAYWLGAPRDHSYEAEFRAVSMKPAFLPSAPGPTMSYYRG QEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQG PPLVWTEIAPIRPESSDSGLGEGDSKRRRVSPYPSSGDSSSPAGAPSPFD KEAEGQFYNYFPN
Molecular Weight 61 kDa including tags
Purity >90% SDS-PAGE.The final product was refolded using unique -€œtemperature shift inclusion body refolding-€ technology and chromatographically purified.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed