Recombinant Human SYVN1/HRD1 Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-8692P
Recombinant Human SYVN1/HRD1 Protein (Tagged)

Recombinant Human SYVN1/HRD1 Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-8692P
Catalog No.: BLA-8692P

Product Overview

Host Species Human
Accession Q86TM6
Synonym 1200010C09Rik DER3 E3 ubiquitin-protein ligase synoviolin HMG coA reductase degradation 1 homolog HRD1 KIAA1810 MGC40372 OTTHUMP00000230429 OTTHUMP00000230430 OTTHUMP00000230431 OTTHUMP00000230432 Synovial apoptosis inhibitor 1 Synovial apoptosis inhibitor 1, synoviolin SYNOVIOLIN Synoviolin 1 Synoviolin 1 isoform b SYVN1 SYVN1_HUMAN
Description Recombinant Human SYVN1/HRD1 Protein (Tagged) was expressed in Baculovirus infected Sf9 cells. It is a Protein fragment
Source Baculovirus infected Sf9 cells
AA Sequence LYMAFMTIMIKVHTFPLFAIRPMYLAMRQFKKAVTDAIMSRRAIRNMNTL YPDATPEELQAMDNVCIICREEMVTGAKRLPCNHIFHTSCLRSWFQRQQT CPTCRMDVLRASLPAQSPPPPEPADQGPPPAPHPPPLLPQPPNFPQGLLP PFPPGMFPLWPPMGPFPPVPPPPSSGEAVAPPSTSAAALSRPSGAATTTA AGTSATAASATASGPGSGSAPEAGPAPGFPFPPPWMGMPLPPPFAFPPMP VPPAGFAGLTPEELRALEGHERQHLEARLQSLRNIHTLLDAAMLQINQYL TVLASLGPPRPATSVNSTEETATTVVAAASSTSIPSSEATTPTPGASPPA PEMERPPAPESVGTEEMPEDGEPDAAELRRRRLQKLESPVAH
Purity >80% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed