Recombinant Human SYT1 Protein

Beta LifeScience SKU/CAT #: BLA-8688P
Recombinant Human SYT1 Protein

Recombinant Human SYT1 Protein

Beta LifeScience SKU/CAT #: BLA-8688P
Catalog No.: BLA-8688P

Product Overview

Host Species Human
Accession P21579
Synonym DKFZp781D2042 FLJ42519 p65 SVP65 Synaptotagmin 2 Synaptotagmin I Synaptotagmin II Synaptotagmin-1 SYT Syt1 SYT1_HUMAN Syt2 SytI
Description Recombinant Human SYT1 Protein was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence MEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKV FLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDR FSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYV PTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKN TLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNLE HHHHHH
Molecular Weight 30 kDa including tags
Purity Greater than 85% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed