Recombinant Human Syndecan 2/HSPG Protein

Beta LifeScience SKU/CAT #: BLA-8668P
Recombinant Human Syndecan 2/HSPG Protein

Recombinant Human Syndecan 2/HSPG Protein

Beta LifeScience SKU/CAT #: BLA-8668P
Catalog No.: BLA-8668P

Product Overview

Host Species Human
Accession P34741
Synonym CD362 Fibroglycan Heparan sulfate proteoglycan core protein HSPG SDC2 SDC2_HUMAN SYND2 Syndecan-2
Description Recombinant Human Syndecan 2/HSPG Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence LDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTS AAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNV
Molecular Weight 37 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed