Recombinant Human Synapsin III Protein

Beta LifeScience SKU/CAT #: BLA-8659P
Recombinant Human Synapsin III Protein

Recombinant Human Synapsin III Protein

Beta LifeScience SKU/CAT #: BLA-8659P
Catalog No.: BLA-8659P

Product Overview

Host Species Human
Synonym cN28H9.2 (synapsin III) OTTHUMP00000028987 SYN 3 SYN3 SYN3_HUMAN Synapsin 3 Synapsin III Synapsin-3
Description Recombinant Human Synapsin III Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MNFLRRRLSDSSFMANLPNGYMTDLQRPDSSTSSPASPAMERRHPQPLAA SFSSPGSSLFSSLSSAMKQAPQATSGLMEPPGPSTPIVQRPRILLVIDDA HTDWSKYFHGKKVNGEIEIRVEQAEFSELNLAAYVTGGCMVDMQVVRNGT KVVSRSFKPDFILVRQHAYSMALGEDYRSLVIGLQYGGLPAVNSLYSVYN FCSKPWVFSQLIKIFHSLGPEKFPLVEQTFFPNHKPMVTAPHFPVVVKLG HAHAGMGKIKVENQLDFQDITSVVAMAKTYATTEAFIDSKYDIRIQKIGS NYKAYMRTSISGNWKANTGSAMLEQVAMTERYRLWVDSCSEMFGGLDICA VKAVHSKDGRDYIIEVMDSSMPLIGEHVEEDRQLMADLVVSKMSQLPMPG GTAPSPLRPWAPQIKSAKSPGQAQLGPQLGQPQPRPPPQGGPRQAQSPQP QRSGSPSQQRLSPQGQQPLSPQSGSPQQQRSPGSPQLSRASSGSSPNQAS KPGATLASQPRPPVQGRSTSQQGEESKKPAPPHPHLNKSQSLTNSLSTSD TSQRGTPSEDEAKAETIRNLRKSFASLFSD
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed