Recombinant Human SWSAP1 Protein

Beta LifeScience SKU/CAT #: BLA-8651P
Recombinant Human SWSAP1 Protein

Recombinant Human SWSAP1 Protein

Beta LifeScience SKU/CAT #: BLA-8651P
Catalog No.: BLA-8651P

Product Overview

Host Species Human
Accession Q6NVH7
Synonym ATPase SWSAP1 C19orf39 SWAP1_HUMAN SWIM-type zinc finger 7-associated protein 1 SWS1-associated protein 1 SWS1AP1 SWSAP1 Zinc finger SWIM type containing 7 associated protein 1 ZSWIM7-associated protein 1 ZSWIM7AP1
Description Recombinant Human SWSAP1 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MNHKVHHHHHHMPAAGPPLLLLGTPGSGKTALLFAAALEAAGEGQGPVLF LTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPA PSLLLLDGLEEYLAEDPEPQEAAYLIALLLDTAAHFSHRLGPGRDCGLMV ALQTQEEAGSGDVLHLALLQRYFPAQCWLQPDAPGPGEHGLRACLEPGGL GPRTEWWVTFRSDGEMMIAPWPTQAGDPSSGKGSSSGGQP
Molecular Weight 26 kDa including tags
Purity >95% SDS-PAGE.Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. The lyo
Recently viewed