Recombinant Human SUSD2 Protein

Beta LifeScience SKU/CAT #: BLA-8645P
Recombinant Human SUSD2 Protein

Recombinant Human SUSD2 Protein

Beta LifeScience SKU/CAT #: BLA-8645P
Catalog No.: BLA-8645P

Product Overview

Host Species Human
Synonym 1200011D11Rik BK65A6.2 FLJ22778 SUSD2 SUSD2_HUMAN Sushi domain-containing protein 2
Description Recombinant Human SUSD2 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MKPALLPWALLLLATALGPGPGPTADAQESCSMRCGALDGPCSCHPTCSG LGTCCLDFRDFCLEILPYSGSMMGGKDFVVRHFKMSSPTDASVICRFKDS IQTLGHVDSSGQVHCVSPLLYESGRIPFTVSLDNGHSFPRAGTWLAVHPN KVSMMEKSELVNETRWQYYGTANTSGNLSLTWHVKSLPTQTITIELWGYE ETGMPYSQEWTAKWSYLYPLATHIPNSGSFTFTPKPAPPSYQRWRVGALR IIDSKNYAGQKDVQALWTNDHALAWHLSDDFREDPVAWARTQCQAWEELE DQLPNFLEELPDCPCTLTQARADSGRFFTDYGCDMEQGSVCTYHPGAVHC VRSVQASLRYGSGQQCCYTADGTQLLTADSSGGSTPDRGHDWGAPPFRTP PRVPSMSHWLYDVLSFYYCCLWAPDCPRYMQRRPSNDCRNYRPPRLASAF GDPHFVTFDGTNFTFNGRGEYVLLEAALTDLRVQARAQPGTMSNGTETRG TGLTAVAVQEGNSDVVEVRLANRTGGLEVLLNQEVLSFTEQSWMDLKGMF LSVAAGDRVSIMLASGAGLEVSVQGPFLSVSVLLPEKFLTHTHGLLGTLN NDPTDDFTLHSGRVLPPGTSPQELFLFGANWTVHNASSLLTYDSWFLVHN FLYQPKHDPTFEPLFPSETTLNPSLAQEAAKLCGDDHFCNFDVAATGSLS TGTATRVAHQLHQRRMQSLQPVVSCGWLAPPPNGQKEGNRYLAGSTIYFH CDNGYSLAGAETSTCQADGTWSSPTPKCQPGRSYAVLLGIIFGGLAVVAA VALVYVLLRRRKGNTHVWGAQP
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed