Recombinant Human Sumo 1 Protein

Beta LifeScience SKU/CAT #: BLA-8611P
Recombinant Human Sumo 1 Protein

Recombinant Human Sumo 1 Protein

Beta LifeScience SKU/CAT #: BLA-8611P
Catalog No.: BLA-8611P

Product Overview

Host Species Human
Accession P63165
Synonym DAP1 GAP modifying protein 1 GAP-modifying protein 1 GMP 1 GMP1 OFC10 PIC 1 PIC1 SENP2 Sentrin Sentrin 1 Small ubiquitin related modifier 1 Small ubiquitin-like modifier 1 Small ubiquitin-related modifier 1 SMT3 SMT3 homolog 3 SMT3 suppressor of mif two 3 homolog 1 SMT3, yeast, homolog 3 Smt3C SMT3H3 SUMO-1 SUMO1 SUMO1_HUMAN Ubiquitin homology domain protein PIC1 Ubiquitin Like 1 Ubiquitin like protein SMT3C Ubiquitin like protein UBL1 Ubiquitin-homology domain protein PIC1 Ubiquitin-like protein SMT3C Ubiquitin-like protein UBL1 UBL 1 UBL1
Description Recombinant Human Sumo 1 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence SDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESY CQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Molecular Weight 19 kDa including tags
Purity >90% Densitometry.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed