Recombinant Human SULT2A1/ST2 Protein
Beta LifeScience
SKU/CAT #: BLA-8606P
Recombinant Human SULT2A1/ST2 Protein
Beta LifeScience
SKU/CAT #: BLA-8606P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q06520 |
Synonym | Alcohol/hydroxysteroid sulfotransferase Bile salt sulfotranasferase 2A1 Bile salt sulfotransferase Dehydroepiandrosterone sulfotransferase DHEA ST DHEA sulfotranasferase DHEA-ST DHEAS EC 2.8.2.14 Hst hSTa Hydroxysteroid sulfotransferase ST2 ST2A1 ST2A1_HUMAN ST2A3 STD sulfotranasferase, dehydroepiandrosterone-preferring Sulfotransferase 2A1 Sulfotransferase family 2A, dehydroepiandrosterone-preferring, member 1 Sulfotransferase family cytosolic 2A dehydroepiandrosterone (DHEA) preferring member 1 Sult2a1 |
Description | Recombinant Human SULT2A1/ST2 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MNHKVHHHHHHMSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVII LTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSE TESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKF IKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQ DTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYV VDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE |
Molecular Weight | 35 kDa including tags |
Purity | >95% SDS-PAGE.Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |