Recombinant Human SULT2A1/ST2 Protein

Beta LifeScience SKU/CAT #: BLA-8606P
Recombinant Human SULT2A1/ST2 Protein

Recombinant Human SULT2A1/ST2 Protein

Beta LifeScience SKU/CAT #: BLA-8606P
Catalog No.: BLA-8606P

Product Overview

Host Species Human
Accession Q06520
Synonym Alcohol/hydroxysteroid sulfotransferase Bile salt sulfotranasferase 2A1 Bile salt sulfotransferase Dehydroepiandrosterone sulfotransferase DHEA ST DHEA sulfotranasferase DHEA-ST DHEAS EC 2.8.2.14 Hst hSTa Hydroxysteroid sulfotransferase ST2 ST2A1 ST2A1_HUMAN ST2A3 STD sulfotranasferase, dehydroepiandrosterone-preferring Sulfotransferase 2A1 Sulfotransferase family 2A, dehydroepiandrosterone-preferring, member 1 Sulfotransferase family cytosolic 2A dehydroepiandrosterone (DHEA) preferring member 1 Sult2a1
Description Recombinant Human SULT2A1/ST2 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MNHKVHHHHHHMSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVII LTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSE TESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKF IKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQ DTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYV VDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Molecular Weight 35 kDa including tags
Purity >95% SDS-PAGE.Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed