Recombinant Human SULT1A1/STP Protein

Beta LifeScience SKU/CAT #: BLA-8597P
Recombinant Human SULT1A1/STP Protein

Recombinant Human SULT1A1/STP Protein

Beta LifeScience SKU/CAT #: BLA-8597P
Catalog No.: BLA-8597P

Product Overview

Host Species Human
Accession P50225
Synonym Aryl sulfotransferase 1 HAST1/HAST2 Human aryl sulfotransferase mRNA complete cds MGC131921 MGC5163 OTTHUMP00000162568 OTTHUMP00000162569 P PST 1 P PST P-PST 1 Phenol sulfating phenol sulfotransferase 1 Phenol sulfotransferase 1 Phenol-sulfating phenol sulfotransferase 1 PST ST1A1 ST1A1_HUMAN ST1A3 STP STP1 Sulfotransferase 1A1 Sulfotransferase family 1A phenol preferring member 1 Sulfotransferase family cytosolic 1A phenol preferring member 1 Sulfotransferase phenol preferring 1 SULT1A1 Thermostable phenol sulfotransferase Thermostable phenol sulfotransferase1 Ts-PST TSPST1
Description Recombinant Human SULT1A1/STP Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MNHKVHHHHHHMELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPD DLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGI PSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSY YHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVL YLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTN YTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSL SFRSEL
Molecular Weight 36 kDa including tags
Purity Greater than 95% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed