Recombinant Human SULT1A1/STP Protein
Beta LifeScience
SKU/CAT #: BLA-8597P
Recombinant Human SULT1A1/STP Protein
Beta LifeScience
SKU/CAT #: BLA-8597P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P50225 |
Synonym | Aryl sulfotransferase 1 HAST1/HAST2 Human aryl sulfotransferase mRNA complete cds MGC131921 MGC5163 OTTHUMP00000162568 OTTHUMP00000162569 P PST 1 P PST P-PST 1 Phenol sulfating phenol sulfotransferase 1 Phenol sulfotransferase 1 Phenol-sulfating phenol sulfotransferase 1 PST ST1A1 ST1A1_HUMAN ST1A3 STP STP1 Sulfotransferase 1A1 Sulfotransferase family 1A phenol preferring member 1 Sulfotransferase family cytosolic 1A phenol preferring member 1 Sulfotransferase phenol preferring 1 SULT1A1 Thermostable phenol sulfotransferase Thermostable phenol sulfotransferase1 Ts-PST TSPST1 |
Description | Recombinant Human SULT1A1/STP Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MNHKVHHHHHHMELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPD DLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGI PSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSY YHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVL YLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTN YTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSL SFRSEL |
Molecular Weight | 36 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of a wide variety of acceptor molecules bearing a hydroxyl or an amine groupe. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Displays broad substrate specificity for small phenolic compounds. Plays an important role in the sulfonation of endogenous molecules such as steroid hormones and 3,3'-diiodothyronin. Mediates the sulfate conjugation of a variety of xenobiotics, including the drugs acetaminophen and minoxidil. Mediates also the metabolic activation of carcinogenic N-hydroxyarylamines leading to highly reactive intermediates capable of forming DNA adducts, potentially resulting in mutagenesis. |
Subcellular Location | Cytoplasm. |
Protein Families | Sulfotransferase 1 family |
Database References | |
Tissue Specificity | Liver, lung, adrenal, brain, platelets and skin. |
Gene Functions References
- SULT1A1 Arg213His (rs9282861) polymorphism might be associated with breast cancer risk, especially among Asian population. PMID: 29233949
- No significant difference was observed in the RNA levels of CYP1A1 and SULT1A1 between the two groups. The frequency of expression of the CYP17 T/C variant tended to be higher and the A allele of COMT polymorphism together with down-regulation of its mRNA expression may be more frequent in Chinese women with idiopathic POI PMID: 28887105
- The importance of SULT1A1 genotype for hepatic methyleugenol DNA adducts in humans, and a strong impact of SULT1A1 copy number variations on SULT1A1 hepatic phenotype. PMID: 28326452
- SULT1A1 role in the metabolic detoxification of heterocyclic aromatic amines PMID: 28160022
- Silencing the SULT1A1 gene led to changes in resveratrol metabolism, with higher intracellular accumulation of the nonmetabolized resveratrol. PMID: 28523759
- the NQO1 Pro187Ser or SULT1A1 Arg213His polymorphism combination with smoking significantly confer susceptibility to BC. [META-ANALYSIS] PMID: 28589969
- SULT1A1 gene copy number affected the minor allele frequency for each single nucleotide polymorphisms tested. Before administration of exogenous hormones, increasing number of G alleles at rs9282861 was associated with earlier age at menopause, lower frequency of night sweats, and less severe insomnia. Variability in onset of menopause and symptoms before initiation of hormone therapy is partly due to SULT1A1 variation. PMID: 27300114
- SULT1A1 copy number variation was negatively correlated with estrone-sulfate to estrone ratio predominantly in males (E1S/E1; p=0.03, r=-0.21) and may be associated with increased risk for common allergies. PMID: 28867356
- This study demonstrates that the presence of His allele and Gln allele in case of SULT1A1 rs9282861 and XRCC1 rs25487, respectively, involve in lung cancer prognosis in Bangladeshi population. PMID: 29110586
- We conclude from these studies that SULT1A1 is involved in the bioactivation of AA-I through the sulfonation of AL-I-NOH, contributing significantly to the toxicities of AA observed in vivo. PMID: 27207664
- Epigallocatechin gallate (EGCG) displays high affinity and specificity for SULT1A1. The allosteric network is shown to involve 14 distinct complexes. ECGG binds both the allosteric site and, relatively weakly, the active site of SULT1A1. PMID: 27356022
- The polymorphism of SULT1A1*2 is not associated with esophageal squamous cell carcinoma risk. PMID: 26455829
- SULT1A1 high Copy Number Variation on high Estrogen Concentration and Tamoxifen-Associated Adverse Drug Reactions in Premenopausal Thai Breast Cancer. PMID: 27221864
- SULT1A1 is responsible for bioactivation of food genotoxicants 5-hydroxymethylfurfural and furfuryl alcohol. PMID: 25370010
- Cytosolic sulfotransferase 1A1 regulates HIV-1 minus-strand DNA elongation in primary human monocyte-derived macrophages. PMID: 26906565
- A systematic analysis showed that three of the twelve human SULTs, SULT1A1, SULT1A3 and SULT1C4, displayed the strongest sulphating activity towards acetaminophen. PMID: 26067475
- Higher SULT1A1 levels were observed in rats as well as in humans exposed to high altitude, when compared to sea-level controls PMID: 26022216
- The present study provided epidemiological evidence for a significantly increased risk of UCB in ever smokers with the Ala/Ala genotype of the GSTO1 gene and the Arg/Arg genotype of the SULT1A1 gene. PMID: 25103078
- Sulfotransferase 1A1 Substrate Selectivity: A Molecular Clamp Mechanism. PMID: 26340710
- The aim of the study was to assess whether selected single nucleotide polymorphisms of CYP1A1 and 2E1, GSTM1, GSTT1, and SULT1A1 influence susceptibility towards hepatocellular carcinoma. PMID: 25654087
- Results indicate that SULT1A1 Arg(213)His may act as a low-penetrance risk allele for developing MBC and could be associated with a specific tumor subtype associated with HER2 overexpression. PMID: 25385181
- Sulfo-conjugation of the multi-hydroxylated metabolites of benzene by human SULT1A1 may represent an important detoxifying pathway. PMID: 25771868
- the SULT1A1 Arg213His polymorphism may contribute UADT cancer risk, but didn't show any association with breast cancer. PMID: 25225888
- that SULT1A1 Arg213His polymorphism is associated with bladder cancer risk. PMID: 25194687
- 3'-Phosphoadenosine 5'-phosphosulfate binds antisynergistically to the subunits of the SULT1A1 dimer. PMID: 25314023
- The results of this meta-analysis indicate that the SULT1A1 Arg213His polymorphism is associated with the risk bladder cancer under a recessive model. PMID: 24763827
- The SNP rs9282861 with GG genotype of SULT1A1 was associated with an elevated risk of total neural tube defects. PMID: 24307569
- The SULT1A1 genetic variability is associated with cancer risk and response to therapy (review). PMID: 24010997
- Association between BRCA2 mutation and SULT1A1 gene deletion in male breast cancer emerged. PMID: 23711090
- SULT1A1 variant allele increases breast cancer risk among subjects who were exposed to high smoked meat intake. PMID: 23157889
- The functional significance of the single nucleotide polymorphisms/haplotypes located upstream of the SULT1A1 start codon. PMID: 23080433
- discussion of possible association between lower-activity of SULT1A1 with sudden cardiac death (both holiday sudden cardiac death in older adults and sudden infant death syndrome) [REVIEW] PMID: 22678655
- We observed a previously unreported association between the SULT1A1 rs9282861 genotype and overall survival of breast cancer patients treated with adjuvant chemotherapy or tamoxifen. PMID: 22708928
- Arg213His polymorphism is not associated with lung cancer. PMID: 22524828
- SULT1A1 Arg213His polymorphism is associated with breast cancer. PMID: 22011087
- Women in Siberia with SNPS in CYP1A1 gene, in CYP1A2 gene,and in the SULT1A1 gene have an increased risk of development of breast cancer . PMID: 21977969
- SULT1A1 Arg213His polymorphism, ethnicity, and smoking may modulate environment-related cancer risk. PMID: 21670965
- Stp1 is important for appropriate regulation of Stk1 function, hemolysin activity, autolysis, and GBS virulence PMID: 22081606
- This meta-analysis demonstrates that there is no association between the SULT1A1 R213H polymorphism and colorectal cancer. PMID: 21695180
- SULT1A1 1/2 does not contribute to the variation in SULT1A1 enzymatic activity when the 3'-UTR SNPs are included in the statistical model PMID: 20881232
- mechanism of SULT1A1-catalyzed sulfation of adenosine 3',5'-diphosphate by para-nitrophenyl sulfate PMID: 21111704
- Only NAT1 showed a significant lower DNA methylation rate in the control group than in the tamoxifen-resistant breast cancer group, and no significant difference in methylation was found in COMT, CYP1A1, CYP2D6, and SULT1A1 genes. PMID: 20628863
- Polymorphism of SULT1A1 Arg213His is associated with breast cancer. PMID: 20663177
- Meta-analysis did not find a significant general relationship between SULT1A1 R213H polymorphism & the risk of breast cancer, but ethnic population analysis revealed a significantly increased breast cancer risk for HH allele carriers among Asians. PMID: 19949855
- The interaction between SULT1A1 and CYP1A2 can play an important role in hepatocarcinogenesis in the Chinese population. PMID: 19906068
- study demonstrates that the loss of SULT1A1 appears to be a characteristic molecular signature of hepatocellular carcinoma. PMID: 19904771
- human CYP2E1 and SULT1A1 activate an endogenous cellular molecule or a medium component to become mutagenic PMID: 19484729
- The high activity SULT1A1*1 allozyme protects against dietary and/or environmental chemicals involved in the pathogenesis of colorectal cancer. PMID: 11692076
- genetic polymorphism in SULT1A1 gene may be associated with increased lung cancer risk PMID: 11804685
- 7-OH-flavone sulfotransferase followed Michaelis-Menten kinetics PMID: 12162852