Recombinant Human Sulfite oxidase Protein

Beta LifeScience SKU/CAT #: BLA-8596P
Recombinant Human Sulfite oxidase Protein

Recombinant Human Sulfite oxidase Protein

Beta LifeScience SKU/CAT #: BLA-8596P
Catalog No.: BLA-8596P

Product Overview

Host Species Human
Accession P51687
Synonym EC 1.8.3.1 mitochondrial Sulfite oxidase Sulfite oxidase mitochondrial Sulfite oxidase, mitochondrial precursor Suox SUOX_HUMAN
Description Recombinant Human Sulfite oxidase Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGSESTHIYTKEEVSSHTSPETGIWVTLGS EVFDVTEFVDLHPGGPSKLMLAAGGPLEPFWALYAVHNQSHVRELLAQYK IGELNPEDKVAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPPELLTEN YITPNPIFFTRNHLPVPNLDPDTYRLHVVGAPGGQSLSLSLDDLHNFPRY EITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVLAQAG HQLCETEAHVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQP LPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPS VDWETVDFDSAPSIQELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRA VIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRLWQLKAPVPAGQKELNI VCKAVDDGYNVQPDTVAPIWNLRGVLSNAW HRVHVYVSP
Molecular Weight 54 kDa including tags
Purity >90% purity as determined by SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed