Recombinant Human STT3A Protein

Beta LifeScience SKU/CAT #: BLA-8581P
Recombinant Human STT3A Protein

Recombinant Human STT3A Protein

Beta LifeScience SKU/CAT #: BLA-8581P
Catalog No.: BLA-8581P

Product Overview

Host Species Human
Accession P46977
Synonym B5 Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A FLJ27038 Integral membrane protein 1 Integral transmembrane protein 1 ITM1 MGC9042 Oligosaccharyl transferase subunit STT3A STT 3A STT3 subunit of the oligosaccharyltransferase complex homolog A STT3-A STT3A STT3A_HUMAN TMC Transmembrane protein TMC
Description Recombinant Human STT3A Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence GGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYT EAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRG
Molecular Weight 37 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed