Recombinant Human STT3A Protein
Beta LifeScience
SKU/CAT #: BLA-8581P
Recombinant Human STT3A Protein
Beta LifeScience
SKU/CAT #: BLA-8581P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P46977 |
Synonym | B5 Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A FLJ27038 Integral membrane protein 1 Integral transmembrane protein 1 ITM1 MGC9042 Oligosaccharyl transferase subunit STT3A STT 3A STT3 subunit of the oligosaccharyltransferase complex homolog A STT3-A STT3A STT3A_HUMAN TMC Transmembrane protein TMC |
Description | Recombinant Human STT3A Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | GGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYT EAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRG |
Molecular Weight | 37 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |