Recombinant Human Sts1 Protein

Beta LifeScience SKU/CAT #: BLA-8580P
Recombinant Human Sts1 Protein

Recombinant Human Sts1 Protein

Beta LifeScience SKU/CAT #: BLA-8580P
Catalog No.: BLA-8580P

Product Overview

Host Species Human
Synonym Cbl interacting protein p70 Cbl interacting protein Sts 1 Cbl interacting protein Sts1 Cbl-interacting protein p70 KIAA1959 MGC15437 Nm23 phosphorylated unknown substrate p70 SH3 domain containing 70 kDa protein Sts 1 STS-1 STS1 Suppressor of T cell receptor signaling 1 Suppressor of T-cell receptor signaling 1 T-cell ubiquitin ligand 2 TULA-2 Tyrosine-protein phosphatase STS1/TULA2 Ubash3b Ubiquitin associated and SH3 domain containing B Ubiquitin-associated and SH3 domain-containing protein B UBS3B_HUMAN
Description Recombinant Human Sts1 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MAQYGHPSPLGMAAREELYSKVTPRRNRQQRPGTIKHGSALDVLLSMGFP RARAQKALASTGGRSVQAACDWLFSHVGDPFLDDPLPREYVLYLRPTGPL AQKLSDFWQQSKQICGKNKAHNIFPHITLCQFFMCEDSKVDALGEALQTT VSRWKCKFSAPLPLELYTSSNFIGLFVKEDSAEVLKKFAADFAAEAASKT EVHVEPHKKQLHVTLAYHFQASHLPTLEKLAQNIDVKLGCDWVATIFSRD IRFANHETLQVIYPYTPQNDDELELVPGDFIFMSPMEQTSTSEGWIYGTS LTTGCSGLLPENYITKADECSTWIFHGSYSILNTSSSNSLTFGDGVLERR PYEDQGLGETTPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFG KYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPITVFGCMQAR LVGEALLESNTIIDHVYCSPSLRCVQTAHNILKGLQQENHLKIRVEPGLF EWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYI SRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQ MVRKIPYLGFCSCEELGETGIWQLTDPPILPLTHGPTGGFNWRETLLQE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed