Recombinant Human Stra6 Protein

Beta LifeScience SKU/CAT #: BLA-8575P
Recombinant Human Stra6 Protein

Recombinant Human Stra6 Protein

Beta LifeScience SKU/CAT #: BLA-8575P
Catalog No.: BLA-8575P

Product Overview

Host Species Human
Synonym MCOPCB8 MCOPS9 PP14296 Stimulated by retinoic acid 6 homolog Stimulated by retinoic acid gene 6 protein homolog STRA6 STRA6_HUMAN
Description Recombinant Human Stra6 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG LYHACLASLSILVLLLLAMLVRRRQLWPDCVRGRPGLPSPVDFLAGDRPR AVPAAVFMVLLSSLCLLLPDEDALPFLTLASAPSQDGKTEAPRGAWKILG LFYYAALYYPLAACATAGHTAAHLLGSTLSWAHLGVQVWQRAECPQVPKI YKYYSLLASLPLLLGLGFLSLWYPVQLVRSFSRRTGAGSKGLQSSYSEEY LRNLLCRKKLGSSYHTSKHGFLSWARVCLRHCIYTPQPGFHLPLKLVLSA TLTGTAIYQVALLLLVGVVPTIQKVRAGVTTDVSYLLASFGIVLSEDKQE VVELVKHHLWALEVCYISALVLSCLLTFLVLMRSLVTHRTNLRALHRGAA LDLSPLHRSPHPSRQAIFCWMSFSAYQTAFICLGLLVQQIIFFLGTTALA FLVLMPVLHGRNLLLFRSLESSWPFWLTLALAVILQNMAAHWVFLETHDG HPQLTNRRVLYAATFLLFPLNVLVGAMVATWRVLLSALYNAIHLGQMDLS LLPPRAATLDPGYYTYRNFLKIEVSQSHPAMTAFCSLLLQAQSLLPRTMA APQDSLRPGEEDEGMQLLQTKDSMAKGARPGASRGRARWGLAYTLLHNPT LQVFRKTALLGANGAQP
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed