Recombinant Human STOML1 Protein

Beta LifeScience SKU/CAT #: BLA-8573P
Recombinant Human STOML1 Protein

Recombinant Human STOML1 Protein

Beta LifeScience SKU/CAT #: BLA-8573P
Catalog No.: BLA-8573P

Product Overview

Host Species Human
Synonym EPB72 like 1 hUNC 24 SLP 1 SLP1 Stomatin (EBP72) like 1 Stomatin related protein STORP UNC24
Description Recombinant Human STOML1 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MLGRSGYRALPLGDFDRFQQSSFGFLGSQKGCLSPERGGVGTGADVPQSW PSCLCHGLISFLGFLLLLVTFPISGWFALKIVPTYERMIVFRLGRIRTPQ GPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLSVGADVQFRIW DPVLSVMTVKDLNTATRMTAQNAMTKALLKRPLREIQMEKLKISDQLLLE INDVTRAWGLEVDRVELAVEAVLQPPQDSPAGPNLDSTLQQLALHFLGGS MNSMAGGAPSPGPADTVEMVSEVEPPAPQVGARSSPKQPLAEGLLTALQP FLSEALVSQVGACYQFNVVLPSGTQSAYFLDLTTGRGRVGHGVPDGIPDV VVEMAEADLRALLCRELRPLGAYMSGRLKVKGDLAMAMKLEAVLRALK
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed