Recombinant Human STK3/MST-2 Protein

Beta LifeScience SKU/CAT #: BLA-8557P
Recombinant Human STK3/MST-2 Protein

Recombinant Human STK3/MST-2 Protein

Beta LifeScience SKU/CAT #: BLA-8557P
Catalog No.: BLA-8557P

Product Overview

Host Species Human
Accession Q13188
Synonym 0610042I06Rik EC 2.7.11.1 FLJ90748 KB 1458E12.1 Kinase responsive to stress 1 KRS1 Mammalian STE20 like protein kinase 2 Mammalian STE20-like protein kinase 2 Mammalian sterile 20-like 2 Mess1 MST MST-2 MST2 Mst3 Serine/threonine kinase 3 Serine/threonine kinase 3 (STE20 homolog, yeast) Serine/threonine kinase 3 (Ste20, yeast homolog) Serine/threonine protein kinase 3 Serine/threonine protein kinase Krs1 Serine/threonine-protein kinase 3 Serine/threonine-protein kinase Krs-1 STE20 like kinase MST2 STE20-like kinase MST2 Stk3 STK3_HUMAN wu:fc19e11 zgc:55383
Description Recombinant Human STK3/MST-2 Protein was expressed in Baculovirus infected Sf9 cells. It is a Full length protein
Source Baculovirus infected Sf9 cells
AA Sequence EQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQ VVAIKQVPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEY CGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIKAGN ILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCV ADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDF TDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKR HEEQQRELEEEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTMI EHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQD FKNKSHENCNQNMHEPFPMSKNVFPDNWKVPQDGDFDFLKNLSLEELQMR LKALDPMMEREIEELRQRYTAKRQPILDAMDAKKRRQQNF
Molecular Weight 78 kDa including tags
Purity >41% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Specific activity of this recombinant protein was determined to be 31 pmol/min/μg. Enzyme reaction is conducted in a buffer containing 50 mM HEPES (pH 7.5), 10 mM MgCl2, 1 mM EGTA, 200 µM ATP, 0.01% Brij-35 and 2 µM substrate (Ser/Thr Peptide 7) at 30°C for 1 hour.
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed