Recombinant Human Steroidogenic Factor 1/SF-1 Protein

Beta LifeScience SKU/CAT #: BLA-8541P
Recombinant Human Steroidogenic Factor 1/SF-1 Protein

Recombinant Human Steroidogenic Factor 1/SF-1 Protein

Beta LifeScience SKU/CAT #: BLA-8541P
Catalog No.: BLA-8541P

Product Overview

Host Species Human
Accession Q13285
Synonym AD4BP Adrenal 4 binding protein Adrenal 4-binding protein ELP FTZ 1 FTZ1 FTZF 1 FTZF1 Fushi tarazu factor (Drosophila) homolog 1 Fushi tarazu factor homolog 1 hSF 1 NR5A1 Nuclear receptor AdBP4 Nuclear receptor subfamily 5 group A member 1 POF7 SF 1 SF-1 SF1 SPGF8 SRXY3 Steroid hormone receptor Ad4BP Steroidogenic factor 1 Steroidogenic factor 1 nuclear receptor STF 1 STF-1 STF1 STF1_HUMAN
Description Recombinant Human Steroidogenic Factor 1/SF-1 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCT ESQSCKIDKTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYK RDRALKQQKKAQIRANGFKLETGPPMGVPPPPPPAPDYVLPPSLHGPEPK GLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRAIKSEYPEP YASPPQPGLPYGYPEPFSGGPNVPELILQLLQLEPDEDQVRARILGCLQE PTKSRPDQPAAFGLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQN CWSELLVFDHIYRQVQHGKEGSILLVTGQEVELTTVATQAGSLLHSLVLR AQELVLQLLALQLDRQEFVCLKFIILFSLDLKFLNNHILVKDAQEKANAA LLDYTLCHYPHCGDKFQQLLLCLVEVRALSMQAKEYLYHKHLGNEMPRNN LLIEMLQAKQT
Molecular Weight 77 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed