Recombinant Human STEP / PTPN5 Protein

Beta LifeScience SKU/CAT #: BLA-8539P
Recombinant Human STEP / PTPN5 Protein

Recombinant Human STEP / PTPN5 Protein

Beta LifeScience SKU/CAT #: BLA-8539P
Catalog No.: BLA-8539P

Product Overview

Host Species Human
Accession P54829
Synonym FLJ14427 Neural specific protein tyrosine phosphatase Neural-specific protein-tyrosine phosphatase Protein tyrosine phosphatase non receptor type 5 Protein tyrosine phosphatase non receptor type 5 (striatum enriched) Protein tyrosine phosphatase striatum enriched PTN5 PTN5_HUMAN PTP STEP PTPN 5 Ptpn5 PTPSTEP STEP Striatum-enriched protein-tyrosine phosphatase Tyrosine protein phosphatase non receptor type 5 Tyrosine-protein phosphatase non-receptor type 5
Description Recombinant Human STEP / PTPN5 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MNYEGARSERENHAADDSEGGALDMCCSERLPGLPQPIVMEALDEAEGLQ DSQREMPPPPPPSPPSDPAQKPPPRGAGSHSLTVRSSLCLFAASQFLLAC GVLWFSGYGHIWSQNATNLVSSLLTLLKQLEPTAWLDSGTWGVPSLLLVF LSVGLVLVTTLVWHLLRTPPEPPTPLPPEDRRQSVSRQPSFTYSEWMEEK IEDDFLDLDPVPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLT LDMCTPGCNEEGFGYLMSPREESAREYLLSASRVLQAEELHEKALDPFLL QAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPL SSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITN IEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERG LKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSAGI GRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHH VMSLYEKQLSHQSPE
Molecular Weight 90 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed