Recombinant Human STEP / PTPN5 Protein
Beta LifeScience
SKU/CAT #: BLA-8539P
Recombinant Human STEP / PTPN5 Protein
Beta LifeScience
SKU/CAT #: BLA-8539P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P54829 |
Synonym | FLJ14427 Neural specific protein tyrosine phosphatase Neural-specific protein-tyrosine phosphatase Protein tyrosine phosphatase non receptor type 5 Protein tyrosine phosphatase non receptor type 5 (striatum enriched) Protein tyrosine phosphatase striatum enriched PTN5 PTN5_HUMAN PTP STEP PTPN 5 Ptpn5 PTPSTEP STEP Striatum-enriched protein-tyrosine phosphatase Tyrosine protein phosphatase non receptor type 5 Tyrosine-protein phosphatase non-receptor type 5 |
Description | Recombinant Human STEP / PTPN5 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MNYEGARSERENHAADDSEGGALDMCCSERLPGLPQPIVMEALDEAEGLQ DSQREMPPPPPPSPPSDPAQKPPPRGAGSHSLTVRSSLCLFAASQFLLAC GVLWFSGYGHIWSQNATNLVSSLLTLLKQLEPTAWLDSGTWGVPSLLLVF LSVGLVLVTTLVWHLLRTPPEPPTPLPPEDRRQSVSRQPSFTYSEWMEEK IEDDFLDLDPVPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLT LDMCTPGCNEEGFGYLMSPREESAREYLLSASRVLQAEELHEKALDPFLL QAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPL SSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITN IEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERG LKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSAGI GRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHH VMSLYEKQLSHQSPE |
Molecular Weight | 90 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | May regulate the activity of several effector molecules involved in synaptic plasticity and neuronal cell survival, including MAPKs, Src family kinases and NMDA receptors. |
Subcellular Location | Endoplasmic reticulum membrane; Multi-pass membrane protein. |
Protein Families | Protein-tyrosine phosphatase family, Non-receptor class subfamily |
Database References |
Gene Functions References
- This current study demonstrated that spinal STEP61 regulated LTP of C fiber-evoked field potentials, one of the extensively studied cellular models of central sensitization. PMID: 28389375
- a dual role for PSD-95 in stabilizing synaptic NMDARs by binding directly to GluN2B but also by promoting synaptic exclusion and degradation of the negative regulator STEP61. PMID: 27457929
- STEP is involved in the mechanism of depressive disorders and it is a promising molecular target for atypical antidepressant drugs of new generation. (Review) PMID: 28699511
- Data suggest that PP5/PTPN5 is overexpressed in liver samples from patients with hepatocellular carcinoma (HCC); overexpression of PP5/PTPN5 appears to correlate with tumor burden/stage. Inhibition of PP5/PTPN5 suppresses proliferation and promotes apoptosis of HCC cells; inhibition of PP5/PTPN5 involves activation of AMPK. PMID: 28528695
- A rare missense variant in the PTPN5 gene (rs56234898; minor allele frequency 1.5%) was significantly associated with decreased severity of Post-Burn Hypertrophic Scarring(P = 1.3x10-6). PMID: 26872063
- STEP levels are unchanged in pre-frontal cortex and associative striatum in post-mortem human brain samples from subjects with schizophrenia, bipolar disorder and major depressive disorder PMID: 25786133
- Article focuses on the most recent findings on STEP, discuss how STEP expression and activity are maintained during normal cognitive function, and how disruptions in STEP activity contribute to a number of illnesses. [Review] PMID: 25218562
- Decreased STEP protein activation in corpus striatum contributes to early enhanced apoptotic signaling in YAC model transgenic mice. PMID: 24588402
- This experiments demonstrated that deletion of STEP can enhance experience-induced neuroplasticity and memory formation PMID: 22885232
- The results imply a model in which PTPN5 may play a role in normal cognitive functioning and contribute to aspects of the neuropathology of schizophrenia. PMID: 22555153
- This study identified a novel role for PTPN5 in mediating the development of stress-related cognitive and morphological changes. PMID: 22649233
- STEP(61kDa) is required for Abeta transgene-mediated internalization of GluA1/GluA2 glutamate receptors in a transgenic mousemodel. PMID: 21883219
- STEP contributes to aspects of the pathophysiology in Alzheimer's disease; loss of GluN1/GluN2B subunits from neuronal membranes and Abeta-mediated NMDAR internalization are discussed PMID: 20699650
- findings show that STEP(61) levels are progressively increased in the prefrontal cortex of Alzheimer disease brains PMID: 20427654
- determined high-resolution structures of all of the human family members of Mitogen-Activated Protein Kinase-specific protein tyrosine phosphatases PMID: 16441242
- in colorectal tumors, microsatellite repeats mutation rates are higher than the mean mutation frequency PMID: 19000305